testing with greg
testing with greg
currently we are here:
/lmb/home/pemsley/autobuild/building/hex.lmb.internal_2018-01-06__T07_29_02/test-tar/coot-Linux-x86_64-scientific-linux-6.8-pre-release-gtk2-python
Sat Jan  6 07:45:52 GMT 2018
WARNING:: ccp4 setup file setup-ccp4 does not exist.
/lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/bin/coot --no-graphics --script command-line-greg.scm
INFO:: Using Standard CCP4 Refmac dictionary from CLIBD_MON: /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/
INFO:: Reading coordinate file: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/standard-residues.pdb
 PDB file /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/standard-residues.pdb has been read.
Spacegroup: P 1
initalize graphics molecules...done.
(filter-fileselection-filenames-state)
(get-active-map-drag-flag)
(use-graphics-interface-state)
INFO:: coot.py imported
Running python script /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/lib/python2.7/site-packages/coot/coot_load_modules.py
Good Morning Paul, Welcome to Coot version 0.8.9-pre
(set-display-intro-string "Good Morning Paul, Welcome to Coot version 0.8.9-pre")
(use-graphics-interface-state)
Running python script /lmb/home/pemsley/.coot-preferences/coot_probe_dots.py
Running python script /lmb/home/pemsley/.coot-preferences/pepflip-new.py
Running python script /lmb/home/pemsley/.coot-preferences/rama-plot.py
Running python script /lmb/home/pemsley/.coot-preferences/refine.py
(filter-fileselection-filenames-state)
(get-active-map-drag-flag)
(use-graphics-interface-state)
(set-display-intro-string "Good morning Paul. Welcome to Coot 0.8.9-pre")
(set-display-lists-for-maps 0)
load /lmb/home/pemsley/.coot-preferences/angle-factor.scm
(set-hardware-stereo-angle-factor  1.50)
load /lmb/home/pemsley/.coot-preferences/chain-refine.scm
load /lmb/home/pemsley/.coot-preferences/coot-preferences.scm
(set-filter-fileselection-filenames 0)
(unset-sticky-sort-by-date)
(set-colour-map-rotation-on-read-pdb 21.00)
(set-colour-map-rotation-on-read-pdb-c-only-flag 1)
(set-density-size 22.00)
(set-swap-difference-map-colours 0)
(set-colour-map-rotation-for-map 14.00)
(set-active-map-drag-flag 1)
(set-idle-function-rotate-angle  1.00)
load /lmb/home/pemsley/.coot-preferences/enhanced-ligand.scm
load /lmb/home/pemsley/.coot-preferences/key-bindings.scm
(set-add-terminal-residue-do-post-refine 1)
(set-terminal-residue-do-rigid-body-refine 0)
load /lmb/home/pemsley/.coot-preferences/kill-side-chain.scm
load /lmb/home/pemsley/.coot-preferences/morph-march.scm
load /lmb/home/pemsley/.coot-preferences/startup.scm
load /lmb/home/pemsley/.coot-preferences/template-key-bindings.scm
(filter-fileselection-filenames-state)
(get-active-map-drag-flag)
INFO:: There are 1 command line scripts to run
    command-line-greg.scm
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 0 read successfully
DEBUG:: there were 0 types with no dictionary 
Molecule number -5 is not a valid model molecule
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/2WF6.cif
 mmCIF file /lmb/home/pemsley/data/greg-data/2WF6.cif has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 1 read successfully
DEBUG:: there were 3 types with no dictionary 
in new_molecule_by_atom_selection Something bad happened - No atoms selected
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/ins-code-fragment-pre.pdb
 PDB file /lmb/home/pemsley/data/greg-data/ins-code-fragment-pre.pdb has been read.
No Spacegroup found for this PDB file
INFO:: Found 1 models
   Model 1 had 0 links
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 2 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: Creating directory coot-backup
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_ins-code-fragment-pre.pdb_Sat_Jan__6_07:45:53_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_ins-code-fragment-pre.pdb_Sat_Jan__6_07:45:53_2018_modification_1.pdb.gz
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_ins-code-fragment-pre.pdb_Sat_Jan__6_07:45:53_2018_modification_2.pdb.gz
WARNING:: Error reading bogus.map
Read map bogus.map failed
WARNING:: Can't find file bogus.mtz
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 2.2
INFO grid sampling...Nuvw = ( 160, 192,  96)
INFO:: 0.04 seconds to read MTZ file
INFO:: 0.047 seconds to initialize map
INFO:: 0.047 seconds for FFT
INFO:: 0.01 seconds for statistics
      Map mean: ........ 1.18457e-09
      Map sigma: ....... 0.311501
      Map maximum: ..... 3.05176
      Map minimum: ..... -0.921659
INFO:: 0.29 seconds for contour map
INFO:: 0.434 seconds in total
WARNING:: file xx-missing.mtz does not exist
>>>>>> CCP4 library signal library_file:End of File (Error)
	 raised in ccp4_file_raw_read <<<<<<
>>>>>> System signal 0:Success (Error)
	 raised in ccp4_file_rarch <<<<<<
>>>>>> CCP4 library signal library_file:End of File (Error)
	 raised in ccp4_file_raw_read <<<<<<
>>>>>> System signal 0:Success (Error)
	 raised in ccp4_file_readint <<<<<<
>>>>>> System signal 0:Success (Error)
	 raised in ccp4_file_read <<<<<<
>>>>>> CCP4 library signal library_file:End of File (Error)
	 raised in ccp4_file_raw_read <<<<<<
>>>>>> System signal 0:Success (Error)
	 raised in ccp4_file_readchar <<<<<<
>>>>>> CCP4 library signal mtz:Read failed (Error)
	 raised in MtzGet <<<<<<
CCP4MTZfile: open_read - File missing or corrupted: /lmb/home/pemsley/data/greg-data/broken.mtz
INFO:: not an mtz file: /lmb/home/pemsley/data/greg-data/broken.mtz
INFO:: making conventional map from MTZ filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz using FWT PHWT
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 2.2
INFO grid sampling...Nuvw = ( 160, 192,  96)
INFO:: 0.031 seconds to read MTZ file
INFO:: 0.001 seconds to initialize map
INFO:: 0.041 seconds for FFT
INFO:: 0.009 seconds for statistics
      Map mean: ........ 1.18457e-09
      Map sigma: ....... 0.311501
      Map maximum: ..... 3.05176
      Map minimum: ..... -0.921659
INFO:: 0.231 seconds for contour map
INFO:: 0.313 seconds in total
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/3hfl_sigmaa.mtz
Number of OBSERVED reflections: 17920
INFO:: finding ASU unique map points with sampling rate 2.2
INFO grid sampling...Nuvw = (  96, 128, 132)
INFO:: 0.035 seconds to read MTZ file
INFO:: 0.026 seconds to initialize map
INFO:: 0.04 seconds for FFT
INFO:: 0.01 seconds for statistics
      Map mean: ........ -7.23799e-11
      Map sigma: ....... 0.260405
      Map maximum: ..... 1.77531
      Map minimum: ..... -1.05473
INFO:: 0.078 seconds for contour map
INFO:: 0.189 seconds in total
INFO:: map file type was determined to be CCP4 type
INFO:: attempting to read CCP4 map: test-3hfl.map
closing CCP4 map: test-3hfl.map
Map statistics: mean: -7.23799e-11 st.d: 0.260405
Map statistics: min: -1.05473, max: 1.77531
  -1.01936    1
 -0.948606    16
 -0.877855    66
 -0.807104    242
 -0.736353    732
 -0.665602    1945
 -0.594851    4226
   -0.5241    8607
 -0.453349    15185
 -0.382598    23838
 -0.311847    34975
 -0.241096    51260
 -0.170345    75438
-0.0995937    108221
-0.0288427    131057
 0.0419084    120860
  0.112659    80202
   0.18341    42617
  0.254161    23468
  0.324912    17082
  0.395663    14264
  0.466414    12492
  0.537165    10884
  0.607916    9094
  0.678667    7521
  0.749418    5689
  0.820169    4124
   0.89092    2846
  0.961672    1799
   1.03242    1021
   1.10317    604
   1.17392    269
   1.24468    145
   1.31543    98
   1.38618    59
   1.45693    26
   1.52768    17
   1.59843    8
   1.66918    7
   1.73993    3
   1.81068    0
INFO:: n grid points:             811008
INFO:: mean before filtering:     -7.23799e-11
INFO:: variance before filtering: 0.0678109
INFO:: filter by ignoring 596 of 811008 counts ( = 0.07349%) with values around -0.007759 from bin 3699 of 10000
      Map mean: ........ 5.494e-06
      Map rmsd: ........ 0.2605
      Map maximum: ..... 1.775
      Map minimum: ..... -1.055
WARNING:: Error reading .
. is a directory.
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 7 read successfully
DEBUG:: there were 0 types with no dictionary 
/lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures successfully opened
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i0v.pdb
64 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i0v.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1e4m.pdb
494 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1e4m.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1ird.pdb
136 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1ird.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1iqz.pdb
75 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1iqz.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1jcl.pdb
247 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1jcl.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1fn8.pdb
4 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1fn8.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1hyo.pdb
411 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1hyo.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i0d.pdb
326 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i0d.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1hdh.pdb
520 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1hdh.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1gk9.pdb
0 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1gk9.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1hdo.pdb
137 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1hdo.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1f9v.pdb
143 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1f9v.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1es9.pdb
205 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1es9.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1j98.pdb
149 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1j98.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1f4p.pdb
140 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1f4p.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1kth.pdb
51 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1kth.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1h97.pdb
142 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1h97.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1c7k.pdb
127 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1c7k.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1jf8.pdb
123 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1jf8.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1h4x.pdb
106 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1h4x.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1heu.pdb
0 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1heu.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1hg7.pdb
20 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1hg7.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1eb6.pdb
172 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1eb6.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1f86.pdb
108 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1f86.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i40.pdb
0 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i40.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1ds1.pdb
318 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1ds1.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1g7a.pdb
14 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1g7a.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1dy5.pdb
119 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1dy5.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1jg1.pdb
208 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1jg1.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1j9b.pdb
131 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1j9b.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1jbe.pdb
68 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1jbe.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1hvb.pdb
294 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1hvb.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1jfb.pdb
0 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1jfb.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i2t.pdb
54 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i2t.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i12.pdb
45 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i12.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i8o.pdb
108 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i8o.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1g6x.pdb
23 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1g6x.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1c75.pdb
0 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1c75.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1gmx.pdb
33 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1gmx.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1hbn.pdb
543 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1hbn.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1ejg.pdb
There was an error reading /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1ejg.pdb. 
ERROR 42 READ: Duplicate sequence number and insertion code.
         LINE #868
     ATOM    414  CA BSER A  22       6.034  13.399  -2.687  0.21  1.55           C  

Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i27.pdb
68 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i27.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1g66.pdb
171 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1g66.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1e29.pdb
129 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1e29.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1g61.pdb
218 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1g61.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1f94.pdb
56 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1f94.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1ga6.pdb
364 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1ga6.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1g4i.pdb
13 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1g4i.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1ka1.pdb
349 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1ka1.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1koi.pdb
35 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1koi.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1fye.pdb
155 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1fye.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1e9g.pdb
52 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1e9g.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1et1.pdb
29 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1et1.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1g2b.pdb
0 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1g2b.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1jl1.pdb
145 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1jl1.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1jk3.pdb
72 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1jk3.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1g2y.pdb
24 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1g2y.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1k7c.pdb
228 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1k7c.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1fsg.pdb
226 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1fsg.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i4u.pdb
174 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1i4u.pdb
Adding fragments from: /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1euw.pdb
9 fragments garnered from /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/reference-structures/1euw.pdb
INFO:: 8375 fragments found in total       of which 0 were 5 peptides 
target fragment start res: 10 had 29 db fragment hits, ilength=6
target fragment start res: 13 had 1772 db fragment hits, ilength=6
breaking out of match_target_fragment 6 with iresno= 16
merge fragments 10 to 20 with 2 fit sets to merge
The merging is complete
mainchain_fragment from 10 to 20
done mainchain_fragment
successfully set cell and symmetry
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-add-terminal-1-test.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-add-terminal-1-test.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 83/90
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 9 read successfully
DEBUG:: there were 0 types with no dictionary 
fitting terminal residue with 1000 random trials
                     called fit_terminal_residue_generic() residue-seqnum: 1 offset: -1
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
INFO:: mutating residue in add_cb_to_terminal_res
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-add-terminal-1-test.pdb_Sat_Jan__6_07:45:58_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/atom_selection_from_tutorial-add-terminal-1-test.pdb_Sat_Jan__6_07:45:58_2018_modification_0.pdb.gz
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/frag-2wot.pdb
 PDB file /lmb/home/pemsley/data/greg-data/frag-2wot.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 11 read successfully
DEBUG:: there were 0 types with no dictionary 
WARNING:: add_terminal_residue_using_phi_psi() residue not found for "XX" 276
INFO:: backup file coot-backup/atom_selection_from_tutorial-modern.pdb_Sat_Jan__6_07:46:00_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/atom_selection_from_tutorial-modern.pdb_Sat_Jan__6_07:46:00_2018_modification_1.pdb.gz
INFO:: backup file coot-backup/atom_selection_from_tutorial-modern.pdb_Sat_Jan__6_07:46:00_2018_modification_2.pdb.gz
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/rotamer-test-fragment.pdb
 PDB file /lmb/home/pemsley/data/greg-data/rotamer-test-fragment.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 14 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: Reading rotamer probability tables...
primitive chis: Failure to find correct atom quads in residue atoms
  quad needed: : N  :  : CA :  : CB :  : OG1:
INFO:: un altconfed rotamer with no chis [spec: 1 "A" 16 ""]
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/res098.pdb
 PDB file /lmb/home/pemsley/data/greg-data/res098.pdb has been read.
Spacegroup: P 41 21 2
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 15 read successfully
DEBUG:: there were 0 types with no dictionary 
created 6 bond       restraints 
created 6 angle      restraints 
created 0 plane      restraints 
created 1 chiral vol restraints 
created 13 restraints

INFO:: GetSelIndex (make_flanking_atoms_restraints) returned 2 residues (flanking restraints)
INFO:: GetSelIndex (make_flanking_atoms_restraints) returned 2 residues (flanking restraints)
Flanking residue restraints: 
   2 bond    links
   7 angle   links
   4 plane   links
   2 trans-peptide links
   0 parallel plane restraints
INFO:: make_restraints(): made 9 non-bonded restraints
initial distortion_score: 26.65
    Initial RMS Z values
bonds:      0.2292
angles:     0.4339
torsions:   N/A 
planes:     0.3222
non-bonded: 0
chiral vol: 0.1627
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 149) at 9.945
    Final Estimated RMS Z Scores:
bonds:      0.09591
angles:     0.6652
torsions:   N/A 
planes:     0.6486
non-bonded: 0
chiral vol: 0.5914
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 8.97
debug:: restraints results 1 5 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_res098.pdb_Sat_Jan__6_07:46:02_2018_modification_0.pdb.gz
INFO:: replace_coords: 7 atoms updated.
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 16 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 2.2
INFO grid sampling...Nuvw = ( 160, 192,  96)
INFO:: 0.032 seconds to read MTZ file
INFO:: 0.001 seconds to initialize map
INFO:: 0.043 seconds for FFT
INFO:: 0.01 seconds for statistics
      Map mean: ........ 1.185e-09
      Map sigma: ....... 0.3115
      Map maximum: ..... 3.052
      Map minimum: ..... -0.9217
INFO:: 0.287 seconds for contour map
INFO:: 0.373 seconds in total
DEBUG:: split_residue table 
   0  N   ::
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:46:03_2018_modification_0.pdb.gz
split_residue(int atom_index, int alt_conf_split_type) returns 0 
debug:: split_residue() returned 0 ""
------------ ERROR! -------------------
       moving_atoms_asc_type not known: 0
------------ ERROR! -------------------
attempting to delete NULL moving_atoms_asc.mol
ignoring 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:46:03_2018_modification_1.pdb.gz
INFO:: replace_coords: 8 atoms updated.
Fitting score for best rotamer: 12.05
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/pdb3knw.ent
 PDB file /lmb/home/pemsley/data/greg-data/pdb3knw.ent has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 30 links
in add_molecular_symmetry_matrices() made 1 biomt matrices
INFO:: NCS chain comparison 185/199
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 18 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_pdb3knw.ent_Sat_Jan__6_07:46:04_2018_modification_0.pdb.gz
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/pdb1py3.ent
 PDB file /lmb/home/pemsley/data/greg-data/pdb1py3.ent has been read.
Spacegroup: C 1 2 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 1 biomt matrices
INFO:: NCS chain comparison 91/204
INFO:: NCS chain comparison 90/204
INFO:: NCS chain comparison 175/179
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain C onto Chain B"
Molecule 19 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_pdb1py3.ent_Sat_Jan__6_07:46:05_2018_modification_0.pdb.gz
INFO:: (result) TYR swapped atoms in [spec: 1 "A" 30 ""] TYR
INFO:: (result) ASP swapped atoms in [spec: 1 "A" 35 ""] ASP
INFO:: (result) PHE swapped atoms in [spec: 1 "A" 39 ""] PHE
INFO:: (result) TYR swapped atoms in [spec: 1 "A" 54 ""] TYR
INFO:: (result) PHE swapped atoms in [spec: 1 "A" 57 ""] PHE
INFO:: (result) ASP swapped atoms in [spec: 1 "A" 66 ""] ASP
INFO:: (result) PHE swapped atoms in [spec: 1 "A" 90 ""] PHE
INFO:: (result) ASP swapped atoms in [spec: 1 "B" 2 ""] ASP
INFO:: (result) TYR swapped atoms in [spec: 1 "B" 30 ""] TYR
INFO:: (result) ASP swapped atoms in [spec: 1 "B" 35 ""] ASP
INFO:: (result) PHE swapped atoms in [spec: 1 "B" 39 ""] PHE
INFO:: (result) TYR swapped atoms in [spec: 1 "B" 54 ""] TYR
INFO:: (result) TYR swapped atoms in [spec: 1 "B" 77 ""] TYR
INFO:: (result) ASP swapped atoms in [spec: 1 "B" 85 ""] ASP
INFO:: (result) PHE swapped atoms in [spec: 1 "B" 90 ""] PHE
INFO:: (result) TYR swapped atoms in [spec: 1 "C" 30 ""] TYR
INFO:: (result) TYR swapped atoms in [spec: 1 "C" 32 ""] TYR
INFO:: (result) ASP swapped atoms in [spec: 1 "C" 35 ""] ASP
INFO:: (result) PHE swapped atoms in [spec: 1 "C" 39 ""] PHE
WARNING:: missing atoms bad atom indexing in atom_index_quad::torsion()
WARNING:: missing atoms bad atom indexing in atom_index_quad::torsion()
INFO:: (result) TYR swapped atoms in [spec: 1 "C" 54 ""] TYR
INFO:: (result) PHE swapped atoms in [spec: 1 "C" 57 ""] PHE
INFO:: (result) TYR swapped atoms in [spec: 1 "C" 81 ""] TYR
INFO:: (result) ASP swapped atoms in [spec: 1 "C" 85 ""] ASP
INFO:: (result) PHE swapped atoms in [spec: 1 "C" 90 ""] PHE
INFO:: (result) ASP swapped atoms in [spec: 1 "C" 94 ""] ASP
Good morning Paul Emsley PI Garib Murshudov added 28092012. Welcome to Coot 0.8.9-pre.

                 === greg-tests tests ===

Loading greg-tests/begin.grg ...
===============================================================
==================== Testing ==================================
===============================================================
Loaded greg-tests/begin.grg
Running 01-pdb+mtz.scm ...
Entered testcase - Post Go To Atom no molecules
PASS: Post Go To Atom no molecules
Entered testcase - Close bad molecule
PASS: Close bad molecule
Entered testcase - Read coordinates test
PASS: Read coordinates test
Entered testcase - New molecule from bogus molecule
PASS: New molecule from bogus molecule
Entered testcase - Don't crash on empty NCS from mmCIF file
   closing molecule number 1
PASS: Don't crash on empty NCS from mmCIF file
Entered testcase - New molecule from bogus atom selection
   INFO:: pre-n-molecules 2   post-n-molecules 2
PASS: New molecule from bogus atom selection
Entered testcase - ins code change and Goto atom over an ins code break
   pre and post ins codes: "" "A"
   pass: ("A" 68 "" " CA ") 
   pass: ("A" 68 "B" " CA ") 
   pass: ("A" 68 "B" " CA ") 
   pass: ("A" 68 "B" " CA ") 
   pass: ("A" 68 "A" " CA ") 
   pass: ("A" 68 "" " CA ") 
   pass: ("A" 66 "" " CA ") 
PASS: ins code change and Goto atom over an ins code break
Entered testcase - Read a bogus map
PASS: Read a bogus map
Entered testcase - Read MTZ test
PASS: Read MTZ test
Entered testcase - Auto-read bad MTZ test
   got status: #()
   got status: #()
PASS: Auto-read bad MTZ test
Entered testcase - Map Sigma 
   INFO:: map sigmas 0.311500996351242 #f
PASS: Map Sigma 
Entered testcase - Another Level Test
PASS: Another Level Test
Entered testcase - Sharpen map from map
PASS: Sharpen map from map
Entered testcase - db-main makes mainchain
PASS: db-main makes mainchain
Entered testcase - Set Atom Attribute Test
PASS: Set Atom Attribute Test
Entered testcase - Add Terminal Residue Test
PASS: Add Terminal Residue Test
Entered testcase - Adding residue by phi psi, no crash
PASS: Adding residue by phi psi, no crash
Entered testcase - Select by Sphere
   Sphere mol: there are 4 residues in chain "B"
   Found 20 sphere atoms 
PASS: Select by Sphere
Entered testcase - Test Views
PASS: Test Views
Entered testcase - Label Atoms and Delete
PASS: Label Atoms and Delete
Entered testcase - Rotamer outliers
PASS: Rotamer outliers
Entered testcase - Alt Conf Occ Sum Reset
   For atom " CE " "A" returning occ 0.699999988079071
   For atom " CE " "B" returning occ 0.200000002980232
   For atom " NZ " "A" returning occ 0.699999988079071
   For atom " NZ " "B" returning occ 0.200000002980232
   For atom " CE " "A" returning occ 0.699999988079071
   For atom " CE " "B" returning occ 0.200000002980232
   For atom " NZ " "A" returning occ 0.699999988079071
   For atom " NZ " "B" returning occ 0.200000002980232
   test for closeness: 1.79999998211861 1.79999998211861
PASS: Alt Conf Occ Sum Reset
Entered testcase - Correct occupancies after auto-fit rotamer on alt-confed residue
PASS: Correct occupancies after auto-fit rotamer on alt-confed residue
Entered testcase - Rotamers work on MSE
    se-1: (("SE  " "") (0.699999988079071 2.0 "SE" "") (58.7999992370605 66.5329971313477 0.0469999983906746))
    se-2: (("SE  " "") (0.699999988079071 2.0 "SE" "") (60.1311187744141 69.3484802246094 -0.673518776893616))
PASS: Rotamers work on MSE
Entered testcase - Hs are correctly swapped on a TYR
bond-length-within-tolerance? bond-length 0.93069991132425 with target 0.93 and tolerance 0.02 for atom ((" CD1" "") (1.0 (22.3700008392334 0.288300007581711 0.351099997758865 0.210400000214577 0.0551000013947487 0.0124000003561378 0.00350000010803342) " C" "") (61.2610015869141 -13.2200002670288 1.25)) is ((" HD1" "") (1.0 22.7800006866455 " H" "") (61.4099998474121 -12.8690004348755 2.09899997711182))
bond-length-within-tolerance? bond-length 0.930136198469449 with target 0.93 and tolerance 0.02 for atom ((" CD2" "") (1.0 (24.4099998474121 0.258899986743927 0.405699998140335 0.262800008058548 0.0627999976277351 -0.0269000008702278 -0.00970000028610229) " C" "") (59.9500007629395 -13.3459997177124 -0.740000009536743)) is ((" HD2" "") (1.0 24.3099994659424 " H" "") (59.2050018310547 -13.0869998931885 -1.23300004005432))
bond-length-within-tolerance? bond-length 0.930888837109095 with target 0.93 and tolerance 0.02 for atom ((" CE1" "") (1.0 (22.1599998474121 0.280600011348724 0.314999997615814 0.246199995279312 0.0603000000119209 -0.0186000000685453 -0.0172000005841255) " C" "") (62.1650009155273 -14.1079998016357 0.726000010967255)) is ((" HE1" "") (1.0 22.1200008392334 " H" "") (62.9140014648438 -14.3520002365112 1.22200000286102))
bond-length-within-tolerance? bond-length 0.929591631283786 with target 0.93 and tolerance 0.02 for atom ((" CE2" "") (1.0 (23.9099998474121 0.281399995088577 0.359200000762939 0.267500013113022 0.0529999993741512 -0.0285000000149012 -0.0131999999284744) " C" "") (60.8559989929199 -14.2670001983643 -1.29900002479553)) is ((" HE2" "") (1.0 23.5400009155273 " H" "") (60.7249984741211 -14.6049995422363 -2.15499997138977))
INFO:: 25 residues had their atoms swapped
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 20 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 2.2
INFO grid sampling...Nuvw = ( 160, 192,  96)
INFO:: 0.03 seconds to read MTZ file
INFO:: 0.002 seconds to initialize map
INFO:: 0.04 seconds for FFT
INFO:: 0.01 seconds for statistics
      Map mean: ........ 1.185e-09
      Map sigma: ....... 0.3115
      Map maximum: ..... 3.052
      Map minimum: ..... -0.9217
INFO:: 0.254 seconds for contour map
INFO:: 0.336 seconds in total
DEBUG:: split_residue table 
   0  N   ::
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:46:07_2018_modification_0.pdb.gz
split_residue(int atom_index, int alt_conf_split_type) returns 0 
debug:: split_residue() returned 0 ""
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/alt-conf-pepflip-test.pdb
 PDB file /lmb/home/pemsley/data/greg-data/alt-conf-pepflip-test.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 22 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_alt-conf-pepflip-test.pdb_Sat_Jan__6_07:46:08_2018_modification_0.pdb.gz
flipped 65 A
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern-cis-pep-12A_refmac0.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern-cis-pep-12A_refmac0.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 23 read successfully
DEBUG:: there were 0 types with no dictionary 
in molecule_class_info_t::cis_trans_conversion() atom_sel.mol is 0x515af00
omega: 1 12.77 degrees 
INFO This is a CIS peptide - making it TRANS
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern-cis-pep-12A_refmac0.pdb_Sat_Jan__6_07:46:10_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern-cis-pep-12A_refmac0.pdb_Sat_Jan__6_07:46:10_2018_modification_1.pdb.gz
INFO:: Removing CIS peptide from PDB header: A 11 A 12 
flipped 11 A
INFO:: mutate 11 A to a GLY
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern-cis-pep-12A_refmac0.pdb_Sat_Jan__6_07:46:10_2018_modification_2.pdb.gz
created 10 bond       restraints 
created 10 angle      restraints 
created 0 plane      restraints 
created 1 chiral vol restraints 
created 21 restraints

INFO:: GetSelIndex (make_link_restraints) returned 2 residues (for link restraints) between (and including) residues 11 and 12 of chain A
Link restraints: 
   1 bond    links
   4 angle   links
   2 plane   links
   1 trans-peptide links
   0 parallel plane restraints
INFO:: GetSelIndex (make_flanking_atoms_restraints) returned 2 residues (flanking restraints)
INFO:: GetSelIndex (make_flanking_atoms_restraints) returned 2 residues (flanking restraints)
Flanking residue restraints: 
   2 bond    links
   7 angle   links
   4 plane   links
   2 trans-peptide links
   0 parallel plane restraints
INFO:: make_restraints(): made 27 non-bonded restraints
initial distortion_score: 4092
    Initial RMS Z values
bonds:      15.46
angles:     7.124
torsions:   N/A 
planes:     2.181
non-bonded: 126.2
chiral vol: 3.045
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 107) at -4926
    Final Estimated RMS Z Scores:
bonds:      0.9339
angles:     0.8076
torsions:   N/A 
planes:     2.589
non-bonded: 0.1811
chiral vol: 0.3754
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 16.67
Refinement elapsed time: 0.013
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern-cis-pep-12A_refmac0.pdb_Sat_Jan__6_07:46:10_2018_modification_3.pdb.gz
INFO:: replace_coords: 11 atoms updated.
INFO:: mutate 11 A to a LEU
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern-cis-pep-12A_refmac0.pdb_Sat_Jan__6_07:46:10_2018_modification_4.pdb.gz
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern-cis-pep-12A_refmac0.pdb_Sat_Jan__6_07:46:10_2018_modification_5.pdb.gz
INFO:: replace_coords: 8 atoms updated.
Fitting score for best rotamer: 8.733
created 14 bond       restraints 
created 16 angle      restraints 
created 0 plane      restraints 
created 2 chiral vol restraints 
created 32 restraints

INFO:: GetSelIndex (make_link_restraints) returned 2 residues (for link restraints) between (and including) residues 11 and 12 of chain A
Link restraints: 
   1 bond    links
   4 angle   links
   2 plane   links
   1 trans-peptide links
   0 parallel plane restraints
INFO:: GetSelIndex (make_flanking_atoms_restraints) returned 2 residues (flanking restraints)
INFO:: GetSelIndex (make_flanking_atoms_restraints) returned 2 residues (flanking restraints)
Flanking residue restraints: 
   2 bond    links
   7 angle   links
   4 plane   links
   2 trans-peptide links
   0 parallel plane restraints
INFO:: make_restraints(): made 63 non-bonded restraints
initial distortion_score: -6101
    Initial RMS Z values
bonds:      0.9077
angles:     1.488
torsions:   N/A 
planes:     3.136
non-bonded: 0.4758
chiral vol: 0.4473
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 84) at -6207
    Final Estimated RMS Z Scores:
bonds:      0.9113
angles:     0.7331
torsions:   N/A 
planes:     2.66
non-bonded: 0.08477
chiral vol: 0.2088
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 16.83
Refinement elapsed time: 0.012
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern-cis-pep-12A_refmac0.pdb_Sat_Jan__6_07:46:10_2018_modification_6.pdb.gz
INFO:: replace_coords: 15 atoms updated.
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 24 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 2.2
INFO grid sampling...Nuvw = ( 160, 192,  96)
INFO:: 0.032 seconds to read MTZ file
INFO:: 0.001 seconds to initialize map
INFO:: 0.045 seconds for FFT
INFO:: 0.011 seconds for statistics
      Map mean: ........ 1.185e-09
      Map sigma: ....... 0.3115
      Map maximum: ..... 3.052
      Map minimum: ..... -0.9217
INFO:: 0.283 seconds for contour map
INFO:: 0.372 seconds in total
created 5 bond       restraints 
created 4 angle      restraints 
created 0 plane      restraints 
created 1 chiral vol restraints 
created 10 restraints

INFO:: GetSelIndex (make_flanking_atoms_restraints) returned 2 residues (flanking restraints)
INFO:: GetSelIndex (make_flanking_atoms_restraints) returned 2 residues (flanking restraints)
Flanking residue restraints: 
   2 bond    links
   6 angle   links
   4 plane   links
   2 trans-peptide links
   0 parallel plane restraints
INFO:: make_restraints(): made 6 non-bonded restraints
initial distortion_score: -2402
    Initial RMS Z values
bonds:      1.674
angles:     1.07
torsions:   N/A 
planes:     0.6113
non-bonded: 9.246
chiral vol: 1.462
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 92) at -2510
    Final Estimated RMS Z Scores:
bonds:      0.8689
angles:     0.9855
torsions:   N/A 
planes:     0.4247
non-bonded: 0.6851
chiral vol: 1.035
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 18.31
Refinement elapsed time: 0.009
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:46:11_2018_modification_0.pdb.gz
INFO:: replace_coords: 6 atoms updated.
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-add-terminal-1-test.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-add-terminal-1-test.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 83/90
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 26 read successfully
DEBUG:: there were 0 types with no dictionary 
DEBUG:: split_residue table 
   0  N   ::
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-add-terminal-1-test.pdb_Sat_Jan__6_07:46:13_2018_modification_0.pdb.gz
split_residue(int atom_index, int alt_conf_split_type) returns 0 
debug:: split_residue() returned 0 ""
INFO:: created 81 restraints

created 34 bond       restraints 
created 39 angle      restraints 
created 2 plane      restraints 
created 6 chiral vol restraints 
Link restraints: 
   2 bond    links
   6 angle   links
   0 plane   links
   4 trans-peptide links
   0 parallel plane restraints
Flanking residue restraints: 
   5 bond    links
   15 angle   links
   10 plane   links
   5 trans-peptide links
   0 parallel plane restraints
INFO:: make_restraints(): made 1979 non-bonded restraints
initial distortion_score: -1.598e+04
    Initial RMS Z values
bonds:      1.743
angles:     1.268
torsions:   N/A 
planes:     0.8383
non-bonded: 0.0005336
chiral vol: 0.8944
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 80) at -1.634e+04
    Final Estimated RMS Z Scores:
bonds:      0.9658
angles:     0.6048
torsions:   N/A 
planes:     0.5873
non-bonded: 0
chiral vol: 0.2529
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 20.89
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-add-terminal-1-test.pdb_Sat_Jan__6_07:46:13_2018_modification_1.pdb.gz
INFO:: replace_coords: 39 atoms updated.
INFO:: created 84 restraints

created 36 bond       restraints 
created 40 angle      restraints 
created 3 plane      restraints 
created 5 chiral vol restraints 
Link restraints: 
   4 bond    links
   12 angle   links
   8 plane   links
   3 trans-peptide links
   0 parallel plane restraints
Flanking residue restraints: 
   2 bond    links
   6 angle   links
   4 plane   links
   2 trans-peptide links
   0 parallel plane restraints
INFO:: make_restraints(): made 1393 non-bonded restraints
initial distortion_score: -7430
    Initial RMS Z values
bonds:      0.9807
angles:     1.018
torsions:   N/A 
planes:     1.787
non-bonded: 4.74
chiral vol: 10.28
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 122) at -1.598e+04
    Final Estimated RMS Z Scores:
bonds:      1.903
angles:     1.789
torsions:   N/A 
planes:     1.623
non-bonded: 0.04616
chiral vol: 1.866
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 22.19
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-add-terminal-1-test.pdb_Sat_Jan__6_07:46:13_2018_modification_2.pdb.gz
INFO:: replace_coords: 41 atoms updated.
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 27 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 2.2
INFO grid sampling...Nuvw = ( 160, 192,  96)
INFO:: 0.032 seconds to read MTZ file
INFO:: 0.001 seconds to initialize map
INFO:: 0.046 seconds for FFT
INFO:: 0.009 seconds for statistics
      Map mean: ........ 1.185e-09
      Map sigma: ....... 0.3115
      Map maximum: ..... 3.052
      Map minimum: ..... -0.9217
INFO:: 0.301 seconds for contour map
INFO:: 0.389 seconds in total
created 29 bond       restraints 
created 32 angle      restraints 
created 2 plane      restraints 
created 4 chiral vol restraints 
created 67 restraints

INFO:: GetSelIndex (make_link_restraints) returned 4 residues (for link restraints) between (and including) residues 40 and 43 of chain A
Link restraints: 
   3 bond    links
   9 angle   links
   6 plane   links
   2 trans-peptide links
   0 parallel plane restraints
INFO:: GetSelIndex (make_flanking_atoms_restraints) returned 2 residues (flanking restraints)
INFO:: GetSelIndex (make_flanking_atoms_restraints) returned 2 residues (flanking restraints)
Flanking residue restraints: 
   2 bond    links
   6 angle   links
   4 plane   links
   2 trans-peptide links
   0 parallel plane restraints
INFO:: make_restraints(): made 315 non-bonded restraints
initial distortion_score: -6107
    Initial RMS Z values
bonds:      0.9358
angles:     1.058
torsions:   N/A 
planes:     1.985
non-bonded: 11.39
chiral vol: 11.48
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 69) at -1.176e+04
    Final Estimated RMS Z Scores:
bonds:      1.841
angles:     1.769
torsions:   N/A 
planes:     2.008
non-bonded: 0.08276
chiral vol: 2.001
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 23.88
Refinement elapsed time: 0.076
----------------------------------------------
----------------------------------------------
     ERROR:: B: last_restraints no cleared up 
----------------------------------------------
----------------------------------------------
created 29 bond       restraints 
created 32 angle      restraints 
created 2 plane      restraints 
created 4 chiral vol restraints 
created 67 restraints

INFO:: GetSelIndex (make_link_restraints) returned 4 residues (for link restraints) between (and including) residues 40 and 43 of chain A
Link restraints: 
   3 bond    links
   9 angle   links
   6 plane   links
   2 trans-peptide links
   0 parallel plane restraints
INFO:: GetSelIndex (make_flanking_atoms_restraints) returned 2 residues (flanking restraints)
INFO:: GetSelIndex (make_flanking_atoms_restraints) returned 2 residues (flanking restraints)
Flanking residue restraints: 
   2 bond    links
   6 angle   links
   4 plane   links
   2 trans-peptide links
   0 parallel plane restraints
INFO:: make_restraints(): made 315 non-bonded restraints
initial distortion_score: 1793
    Initial RMS Z values
bonds:      0.9358
angles:     1.058
torsions:   N/A 
planes:     1.985
non-bonded: 11.39
chiral vol: 11.48
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 6) at -3159
    Final Estimated RMS Z Scores:
bonds:      0.6968
angles:     0.8665
torsions:   N/A 
planes:     1.687
non-bonded: 0.006033
chiral vol: 0.805
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 23.97
Refinement elapsed time: 0.09
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 29 read successfully
DEBUG:: there were 0 types with no dictionary 
----------------------------------------------
----------------------------------------------
     ERROR:: A: last_restraints no cleared up 
----------------------------------------------
----------------------------------------------
INFO:: created 52 restraints

created 23 bond       restraints 
created 25 angle      restraints 
created 0 plane      restraints 
created 4 chiral vol restraints 
Link restraints: 
   3 bond    links
   8 angle   links
   4 plane   links
   2 trans-peptide links
   0 parallel plane restraints
Flanking residue restraints: 
   3 bond    links
   9 angle   links
   6 plane   links
   3 trans-peptide links
   0 parallel plane restraints
INFO:: make_restraints(): made 1265 non-bonded restraints
initial distortion_score: -4134
    Initial RMS Z values
bonds:      1.62
angles:     1.009
torsions:   N/A 
planes:     0.7374
non-bonded: 0.01546
chiral vol: 0.5795
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 112) at -4287
    Final Estimated RMS Z Scores:
bonds:      0.3497
angles:     0.6616
torsions:   N/A 
planes:     0.4307
non-bonded: 0.001981
chiral vol: 0.3994
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 26.8
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:46:20_2018_modification_0.pdb.gz
INFO:: replace_coords: 27 atoms updated.
results: (#t #t #t #t)
PASS: Hs are correctly swapped on a TYR
Entered testcase - Splitting residue leaves no atoms with negative occupancy
PASS: Splitting residue leaves no atoms with negative occupancy
Entered testcase - Pepflip flips the correct alt confed atoms
PASS: Pepflip flips the correct alt confed atoms
Entered testcase - Correction of CISPEP test
   CISPEPs: "3"
PASS: Correction of CISPEP test
Entered testcase - Refine Zone with Alt conf
   refined moved: d=0.291229610524461
PASS: Refine Zone with Alt conf
Entered testcase - Sphere Refine
======= got bond length 1.29188118775558
PASS: Sphere Refine
Entered testcase - Refinement gives useful results
   refinement results: ("" 0 (("Bonds" "Bonds:    1.841" 1.84084844589233) ("Angles" "Angles:   1.769" 1.76895749568939) ("Planes" "Planes:   2.008" 2.00837302207947) ("Non-bonded" "Non-bonded:   0.288" 0.287685066461563) ("Chirals" "Chirals:   2.001" 2.0009491443634)))
   ow factor: 1.90478202700615
   INFO:: setting refinement weight to 16.5371505953419
   refinement results: ("" 0 (("Bonds" "Bonds:    0.697" 0.696841061115265) ("Angles" "Angles:   0.867" 0.866512835025787) ("Planes" "Planes:   1.687" 1.68744623661041) ("Non-bonded" "Non-bonded:   0.078" 0.07767104357481) ("Chirals" "Chirals:   0.805" 0.804979801177979)))
   ow factor: 1.01394498348236
PASS: Refinement gives useful results
Entered testcase - Neighbour-Refine doesn't destroy disulfide bonds
bond-length-within-tolerance? bond-length 2.03057876053709 with target 2.0 and tolerance 0.05 for atom ((" SG " "") (1.0 17.4099998474121 " S" "") (25.6033630371094 27.4919948577881 11.2327871322632)) is ((" SG " "") (1.0 17.4899997711182 " S" "") (24.7640762329102 27.0604934692383 9.43482875823975))
INFO:: created 52 restraints

created 23 bond       restraints 
created 25 angle      restraints 
created 0 plane      restraints 
created 4 chiral vol restraints 
Link restraints: 
   3 bond    links
   8 angle   links
   4 plane   links
   2 trans-peptide links
   0 parallel plane restraints
Flanking residue restraints: 
   3 bond    links
   9 angle   links
   6 plane   links
   3 trans-peptide links
   0 parallel plane restraints
INFO:: make_restraints(): made 1265 non-bonded restraints
initial distortion_score: -4287
    Initial RMS Z values
bonds:      0.3497
angles:     0.6616
torsions:   N/A 
planes:     0.4307
non-bonded: 0.001981
chiral vol: 0.3994
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 1) at -4287
    Final Estimated RMS Z Scores:
bonds:      0.35
angles:     0.6615
torsions:   N/A 
planes:     0.4305
non-bonded: 0.001983
chiral vol: 0.3992
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 26.86
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:46:20_2018_modification_1.pdb.gz
INFO:: replace_coords: 27 atoms updated.
bond-length-within-tolerance? bond-length 2.03060849726443 with target 2.0 and tolerance 0.05 for atom ((" SG " "") (1.0 17.4099998474121 " S" "") (25.6033782958984 27.4920139312744 11.23277759552)) is ((" SG " "") (1.0 17.4899997711182 " S" "") (24.7640781402588 27.0605297088623 9.43478775024414))
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/alt-conf-waters.pdb
 PDB file /lmb/home/pemsley/data/greg-data/alt-conf-waters.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 30 read successfully
DEBUG:: there were 0 types with no dictionary 
masking....masking done
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_alt-conf-waters.pdb_Sat_Jan__6_07:46:21_2018_modification_0.pdb.gz
INFO:: replace_coords: 1 atoms updated.
------------ ERROR! -------------------
       moving_atoms_asc_type not known: 0
------------ ERROR! -------------------
attempting to delete NULL moving_atoms_asc.mol
ignoring 
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/backrub-fragment.pdb
 PDB file /lmb/home/pemsley/data/greg-data/backrub-fragment.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 31 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: NCS chain comparison 93/93
First atom of 720 in first  selection 1/A/1 {ASP}/ N   altLoc :: segid :: pos: (44.88,12.96,8.761) B-factor: 30.17
First atom of 745 in second selection 1/B/1 {ASP}/ N   altLoc :: segid :: pos: (13.88,16.17,23.03) B-factor: 20.03
INFO:: LSQ matched 93 atoms
INFO:: 93 matched atoms had: 
   mean devi: 0.3626
    rms devi: 0.4561
    max devi: 2.14
    min devi: 0.07863
   find_ncs_matrix returns (LSQ) 
|    0.9705,  -0.04709,   -0.2363|
|    0.2357,    0.3883,    0.8909|
|   0.04978,   -0.9203,     0.388|
(      37.8,    -17.17,     13.85)
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
INFO:: backup file coot-backup/Copy_of__lmb_home_pemsley_data_greg-data_backrub-fragment.pdb_Sat_Jan__6_07:46:23_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/Copy_of__lmb_home_pemsley_data_greg-data_backrub-fragment.pdb_Sat_Jan__6_07:46:23_2018_modification_1.pdb.gz
INFO:: replace_coords: 14 atoms updated.
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/coords-B3A.pdb
 PDB file /lmb/home/pemsley/data/greg-data/coords-B3A.pdb has been read.
Spacegroup: P 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 33 read successfully
DEBUG:: there were 1 types with no dictionary 
created 5 bond       restraints 
created 5 angle      restraints 
created 0 plane      restraints 
created 1 chiral vol restraints 
created 11 restraints

INFO:: make_restraints(): made 5 non-bonded restraints
initial distortion_score: 2.951
    Initial RMS Z values
bonds:      0.6619
angles:     0.3737
torsions:   N/A 
planes:     N/A 
non-bonded: 0
chiral vol: 0.25
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 23) at 4.802e-05
    Final Estimated RMS Z Scores:
bonds:      0.001418
angles:     0.002701
torsions:   N/A 
planes:     N/A 
non-bonded: 0
chiral vol: 0.001214
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 31.18
debug:: restraints results 1 4 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_coords-B3A.pdb_Sat_Jan__6_07:46:24_2018_modification_0.pdb.gz
INFO:: replace_coords: 6 atoms updated.
WARNING: in init_refmac_mon_lib, file "/lmb/home/pemsley/data/greg-data/lib-B3A.cif" not found.
init_refmac_mon_lib /lmb/home/pemsley/data/greg-data/lib-B3A.cif had no bond restraints
created 5 bond       restraints 
created 5 angle      restraints 
created 0 plane      restraints 
created 1 chiral vol restraints 
created 11 restraints

INFO:: make_restraints(): made 5 non-bonded restraints
initial distortion_score: 4.802e-05
    Initial RMS Z values
bonds:      0.001418
angles:     0.002701
torsions:   N/A 
planes:     N/A 
non-bonded: 0
chiral vol: 0.001214
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 1) at 3.529e-05
    Final Estimated RMS Z Scores:
bonds:      0.0003425
angles:     0.002614
torsions:   N/A 
planes:     N/A 
non-bonded: 0
chiral vol: 0.0007295
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 31.41
debug:: restraints results 1 4 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_coords-B3A.pdb_Sat_Jan__6_07:46:24_2018_modification_1.pdb.gz
INFO:: replace_coords: 6 atoms updated.
Welcome to Coot
created 5 bond       restraints 
created 5 angle      restraints 
created 0 plane      restraints 
created 1 chiral vol restraints 
created 11 restraints

INFO:: make_restraints(): made 5 non-bonded restraints
initial distortion_score: 3.018
    Initial RMS Z values
bonds:      0.6708
angles:     0.3753
torsions:   N/A 
planes:     N/A 
non-bonded: 0
chiral vol: 0.2536
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 16) at 1.587e-06
    Final Estimated RMS Z Scores:
bonds:      0.0003952
angles:     0.0003942
torsions:   N/A 
planes:     N/A 
non-bonded: 0
chiral vol: 0.0001708
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 31.67
debug:: restraints results 1 4 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_coords-B3A.pdb_Sat_Jan__6_07:46:24_2018_modification_2.pdb.gz
INFO:: replace_coords: 6 atoms updated.
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 2.2
INFO grid sampling...Nuvw = ( 160, 192,  96)
INFO:: 0.033 seconds to read MTZ file
INFO:: 0.002 seconds to initialize map
INFO:: 0.047 seconds for FFT
INFO:: 0.01 seconds for statistics
      Map mean: ........ 1.185e-09
      Map sigma: ....... 0.3115
      Map maximum: ..... 3.052
      Map minimum: ..... -0.9217
INFO:: 0.297 seconds for contour map
INFO:: 0.389 seconds in total
INFO:: Stored refmac parameters: /RNASE3GMP/COMPLEX/FGMP18 /RNASE3GMP/COMPLEX/SIGFGMP18 /RNASE/NATIVE/FreeR_flag is sensible.
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/test-TER-OXT.pdb
 PDB file /lmb/home/pemsley/data/greg-data/test-TER-OXT.pdb has been read.
No Spacegroup found for this PDB file
INFO:: Found 1 models
   Model 1 had 0 links
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 35 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_test-TER-OXT.pdb_Sat_Jan__6_07:46:27_2018_modification_0.pdb.gz
Added OXT at 1/A/14 {ASP}/ OXT altLoc :: segid :: pos: (33.13,-9.09,14.92) B-factor: 45
debug:: add_OXT_to_residue() returns istat 1
WARNING:: This residue already has an OXT - aborting
debug:: add_OXT_to_residue() returns istat 0
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/val.pdb
 PDB file /lmb/home/pemsley/data/greg-data/val.pdb has been read.
No Spacegroup found for this PDB file
INFO:: Found 1 models
   Model 1 had 0 links
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 36 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: mutate 3 C to a HIS
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_val.pdb_Sat_Jan__6_07:46:28_2018_modification_0.pdb.gz
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/2yie-frag.pdb
 PDB file /lmb/home/pemsley/data/greg-data/2yie-frag.pdb has been read.
No Spacegroup found for this PDB file
INFO:: Found 1 models
   Model 1 had 0 links
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 37 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_2yie-frag.pdb_Sat_Jan__6_07:46:30_2018_modification_0.pdb.gz
INFO:: 6 matched atoms had: 
   mean devi: 0.04043
    rms devi: 0.04717
    max devi: 0.08328
    min devi: 0.01301
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/4f8g.pdb
 PDB file /lmb/home/pemsley/data/greg-data/4f8g.pdb has been read.
Spacegroup: I 2 2 2
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 2 biomt matrices
Molecule 38 read successfully
DEBUG:: there were 1 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_4f8g.pdb_Sat_Jan__6_07:46:32_2018_modification_0.pdb.gz
INFO:: 6 matched atoms had: 
   mean devi: 0.04346
    rms devi: 0.04779
    max devi: 0.07399
    min devi: 0.01477
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/4f8g.pdb
 PDB file /lmb/home/pemsley/data/greg-data/4f8g.pdb has been read.
Spacegroup: I 2 2 2
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 2 biomt matrices
Molecule 39 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_4f8g.pdb_Sat_Jan__6_07:46:34_2018_modification_0.pdb.gz
INFO:: 6 matched atoms had: 
   mean devi: 0.03945
    rms devi: 0.04446
    max devi: 0.06949
    min devi: 0.01513
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 2.2
INFO grid sampling...Nuvw = ( 160, 192,  96)
INFO:: 0.027 seconds to read MTZ file
INFO:: 0.001 seconds to initialize map
INFO:: 0.036 seconds for FFT
INFO:: 0.008 seconds for statistics
      Map mean: ........ 1.185e-09
      Map sigma: ....... 0.3115
      Map maximum: ..... 3.052
      Map minimum: ..... -0.9217
INFO:: 0.221 seconds for contour map
INFO:: 0.293 seconds in total
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 2.2
INFO grid sampling...Nuvw = ( 160, 192,  96)
INFO:: 0.033 seconds to read MTZ file
INFO:: 0.001 seconds to initialize map
INFO:: 0.044 seconds for FFT
INFO:: 0.011 seconds for statistics
      Map mean: ........ 1.185e-09
      Map sigma: ....... 0.3115
      Map maximum: ..... 3.052
      Map minimum: ..... -0.9217
INFO:: 0.279 seconds for contour map
INFO:: 0.368 seconds in total
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 42 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: Masking around 64 atoms
Map statistics: mean: -0.001409 st.d: 0.3056
Map statistics: min: -0.9217, max: 3.052
    -0.872    10
   -0.7727    72
   -0.6733    614
    -0.574    3970
   -0.4746    16922
   -0.3753    47064
    -0.276    80118
   -0.1766    105928
  -0.07731    131011
   0.02203    142638
    0.1214    80192
    0.2207    37039
      0.32    20148
    0.4194    14894
    0.5187    11885
     0.618    10488
    0.7174    8813
    0.8167    7252
     0.916    5646
     1.015    4143
     1.115    2992
     1.214    2070
     1.313    1406
     1.413    857
     1.512    523
     1.611    288
     1.711    155
      1.81    64
     1.909    36
     2.009    17
     2.108    8
     2.207    2
     2.307    5
     2.406    4
     2.505    2
     2.605    1
     2.704    1
     2.803    1
     2.903    0
     3.002    0
     3.101    1
PASS: Neighbour-Refine doesn't destroy disulfide bonds
Entered testcase - Rigid Body Refine Alt Conf Waters
PASS: Rigid Body Refine Alt Conf Waters
Entered testcase - Setting multiple atom attributes
PASS: Setting multiple atom attributes
Entered testcase - Tweak Alt Confs on Active Residue
PASS: Tweak Alt Confs on Active Residue
Entered testcase - Backrub rotamer
PASS: Backrub rotamer
Entered testcase - Libcif horne




PASS: Libcif horne
Entered testcase - Refmac Parameters Storage
PASS: Refmac Parameters Storage
Entered testcase - OXT is added before TER record - add only one
   found TER "TER      25      ASP A  14                                                      "
PASS: OXT is added before TER record - add only one
Entered testcase - The position of the oxygen after a mutation
PASS: The position of the oxygen after a mutation
Entered testcase - TER is at the end of a nucleotide after mutation
PASS: TER is at the end of a nucleotide after mutation
Entered testcase - C7 is removed on mutation from a DC
PASS: C7 is removed on mutation from a DC
Entered testcase - C7 is added on mutation to a DC
DEBUG:: atoms is (" P  " " OP1" " OP2" " O5'" " C5'" " C4'" " O4'" " C3'" " O3'" " C2'" " C1'" " N1 " " C2 " " N3 " " C4 " " C5 " " C6 " " O2 " " O4 " " C7 ")
PASS: C7 is added on mutation to a DC
Entered testcase - Mask and difference map
   high-values: (0.989829301834106 0.952502489089966 1.01570284366608 0.636203646659851 0.687578678131104 0.801753640174866 0.738103628158569 1.06824898719788 1.01713168621063 1.01199650764465 0.822739958763123)  low values: (0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0)
Map statistics: mean: -0.001409 st.d: 0.0605
Map statistics: min: -2.993, max: 0.7743
    -2.946    2
    -2.851    2
    -2.757    1
    -2.663    2
    -2.569    3
    -2.475    3
    -2.381    1
    -2.286    4
    -2.192    4
    -2.098    3
    -2.004    4
     -1.91    4
    -1.816    6
    -1.721    12
    -1.627    20
    -1.533    21
    -1.439    29
    -1.345    47
     -1.25    87
    -1.156    85
    -1.062    153
    -0.968    182
   -0.8738    266
   -0.7796    331
   -0.6854    378
   -0.5912    415
   -0.4971    517
   -0.4029    588
   -0.3087    704
   -0.2145    858
   -0.1204    1154
  -0.02619    723063
   0.06799    2120
    0.1622    2190
    0.2563    1772
    0.3505    1353
    0.4447    623
    0.5389    215
    0.6331    49
    0.7272    8
    0.8214    1
   diff-high-values: (0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0)  diff-low-values: (-0.893179178237915 -0.947303891181946 -1.18386614322662 -1.29074668884277 -1.08600687980652 -0.827113389968872 -0.848896324634552 -0.693203151226044 -0.970726668834686 -0.553648948669434)
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 45 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 2.2
INFO grid sampling...Nuvw = ( 160, 192,  96)
INFO:: 0.034 seconds to read MTZ file
INFO:: 0.001 seconds to initialize map
INFO:: 0.044 seconds for FFT
INFO:: 0.011 seconds for statistics
      Map mean: ........ 1.185e-09
      Map sigma: ....... 0.3115
      Map maximum: ..... 3.052
      Map minimum: ..... -0.9217
INFO:: 0.282 seconds for contour map
INFO:: 0.372 seconds in total
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 2.2
INFO grid sampling...Nuvw = ( 160, 192,  96)
INFO:: 0.03 seconds to read MTZ file
INFO:: 0.001 seconds to initialize map
INFO:: 0.04 seconds for FFT
INFO:: 0.01 seconds for statistics
      Map mean: ........ 1.185e-09
      Map sigma: ....... 0.3115
      Map maximum: ..... 3.052
      Map minimum: ..... -0.9217
INFO:: 0.258 seconds for contour map
INFO:: 0.339 seconds in total
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 2.5
INFO grid sampling...Nuvw = ( 180, 216, 108)
INFO:: 0.029 seconds to read MTZ file
INFO:: 0.058 seconds to initialize map
INFO:: 0.054 seconds for FFT
INFO:: 0.013 seconds for statistics
      Map mean: ........ 1.146e-09
      Map sigma: ....... 0.3115
      Map maximum: ..... 3.071
      Map minimum: ..... -0.8775
INFO:: 0.329 seconds for contour map
INFO:: 0.483 seconds in total
INFO:: multiplying map (function index) 0 Nuvw = ( 160, 192,  96) by 1
INFO:: multiplying map (function index) 1 Nuvw = ( 180, 216, 108) by 1
Map statistics: mean: -3.347e-06 st.d: 0.311
Map statistics: min: -0.9165, max: 3.052
   -0.8669    10
   -0.7677    76
   -0.6685    693
   -0.5693    4378
   -0.4701    18338
   -0.3709    49769
   -0.2717    82935
   -0.1725    109167
  -0.07332    133898
   0.02588    127242
    0.1251    79379
    0.2243    36898
    0.3235    20503
    0.4227    15332
    0.5219    12363
    0.6211    10886
    0.7203    9118
    0.8195    7521
    0.9187    5833
     1.018    4256
     1.117    3092
     1.216    2109
     1.315    1444
     1.415    867
     1.514    533
     1.613    302
     1.712    160
     1.811    68
     1.911    40
      2.01    20
     2.109    11
     2.208    7
     2.308    9
     2.407    5
     2.506    5
     2.605    4
     2.704    2
     2.804    4
     2.903    1
     3.002    2
     3.101    0
Map statistics: mean: 3.348e-06 st.d: 0.001086
Map statistics: min: -0.01092, max: 0.009508
  -0.01066    1
  -0.01015    4
 -0.009643    5
 -0.009133    7
 -0.008622    8
 -0.008111    17
 -0.007601    17
  -0.00709    20
 -0.006579    18
 -0.006069    43
 -0.005558    95
 -0.005047    231
 -0.004536    544
 -0.004026    1166
 -0.003515    2162
 -0.003004    4144
 -0.002494    8444
 -0.001983    16358
 -0.001472    32960
-0.0009615    73381
-0.0004508    158320
 5.992e-05    204512
 0.0005706    125583
  0.001081    51958
  0.001592    23884
  0.002103    12696
  0.002613    7551
  0.003124    4844
  0.003635    3115
  0.004146    1977
  0.004656    1264
  0.005167    844
  0.005678    507
  0.006188    274
  0.006699    169
   0.00721    74
   0.00772    47
  0.008231    18
  0.008742    10
  0.009253    8
  0.009763    0
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/multi-carbo-coot-3.pdb
 PDB file /lmb/home/pemsley/data/greg-data/multi-carbo-coot-3.pdb has been read.
Spacegroup: P 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 51 read successfully
DEBUG:: there were 2 types with no dictionary 
created 46 bond       restraints 
created 82 angle      restraints 
created 2 plane      restraints 
created 8 chiral vol restraints 
created 138 restraints

INFO:: GetSelIndex (make_link_restraints) returned 2 residues (for link restraints) between (and including) residues 1 and 2 of chain A
INFO:: glycosidic_linkage type :ALPHA1-4:
Link restraints: 
   1 bond    links
   3 angle   links
   0 plane   links
   0 trans-peptide links
   0 parallel plane restraints
INFO:: make_restraints(): made 750 non-bonded restraints
initial distortion_score: 2652
    Initial RMS Z values
bonds:      6.162
angles:     2.853
torsions:   N/A 
planes:     0.08353
non-bonded: 0.2254
chiral vol: 0.9035
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 887) at 15.99
    Final Estimated RMS Z Scores:
bonds:      0.1009
angles:     0.4225
torsions:   N/A 
planes:     0.0264
non-bonded: 0.0001898
chiral vol: 0.1561
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 52.69
debug:: restraints results 1 5 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_multi-carbo-coot-3.pdb_Sat_Jan__6_07:46:46_2018_modification_0.pdb.gz
INFO:: replace_coords: 46 atoms updated.
PASS: Mask and difference map
Entered testcase - Skeletonize a map
PASS: Skeletonize a map
Entered testcase - Simple Averaged maps
  INFO:: map sigmas: normal 0.311048001050949 and diff-map: 0.0010859053581953
PASS: Simple Averaged maps
Entered testcase - Make a glycosidic linkage
   bond-length: 2.2472998823295: 
   bond-length: 1.44437928674295: 
bond-length-within-tolerance? bond-length 1.44437928674295 with target 1.439 and tolerance 0.04 for atom ((" O4 " "") (1.0 20.0 " O" "") (-3.95734977722168 20.753511428833 1.51749432086945)) is ((" C1 " "") (1.0 20.0 " C" "") (-3.19250345230103 21.6129570007324 2.39076113700867))
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/pdb2qc1-sans-cho.pdb
 PDB file /lmb/home/pemsley/data/greg-data/pdb2qc1-sans-cho.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 3 links
in add_molecular_symmetry_matrices() made 1 biomt matrices
INFO:: NCS chain comparison 4/110
Molecule 52 read successfully
DEBUG:: there were 1 types with no dictionary 
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 1.5
INFO grid sampling...Nuvw = ( 108, 132,  64)
INFO:: 0.041 seconds to read MTZ file
INFO:: 0.014 seconds to initialize map
INFO:: 0.021 seconds for FFT
INFO:: 0.004 seconds for statistics
      Map mean: ........ 1.041e-09
      Map sigma: ....... 0.3115
      Map maximum: ..... 2.978
      Map minimum: ..... -0.875
INFO:: 0.102 seconds for contour map
INFO:: 0.182 seconds in total
......... checking for /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/link-by-torsion-to-NAG-core-NAG-ASN.tab
..that failed - trying  /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/link-by-torsion-to-pyranose-core-NAG-ASN.tab
reading /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/link-by-torsion-to-pyranose-core-NAG-ASN.tab
reading /lmb/home/pemsley/autobuild/Linux-hex.lmb.internal-pre-release-gtk2-python/share/coot/NAG-decorations.tab
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_pdb2qc1-sans-cho.pdb_Sat_Jan__6_07:46:50_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_pdb2qc1-sans-cho.pdb_Sat_Jan__6_07:46:50_2018_modification_1.pdb.gz
INFO:: link torsion generated from link bond restraint
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_pdb2qc1-sans-cho.pdb_Sat_Jan__6_07:46:50_2018_modification_2.pdb.gz
INFO:: replace_coords: 22 atoms updated.
INFO:: created 55 restraints

created 21 bond       restraints 
created 27 angle      restraints 
created 2 plane      restraints 
created 5 chiral vol restraints 
Link restraints: 
   1 bond    links
   2 angle   links
   1 plane   links
   0 trans-peptide links
   0 parallel plane restraints
Flanking residue restraints: 
   2 bond    links
   6 angle   links
   4 plane   links
   2 trans-peptide links
   0 parallel plane restraints
INFO:: make_restraints(): made 930 non-bonded restraints
ERROR:: in add_link_bond_templ() bad atom indexing 1
ERROR:: in add_link_bond_templ() bad atom indexing 2
initial distortion_score: 6.395e+04
    Initial RMS Z values
bonds:      0.3607
angles:     0.6064
torsions:   N/A 
planes:     0.6834
non-bonded: 69.74
chiral vol: 0.4449
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
ERROR:: in add_link_bond_templ() bad atom indexing 1
ERROR:: in add_link_bond_templ() bad atom indexing 2
ERROR:: in add_link_bond_templ() bad atom indexing 1
ERROR:: in add_link_bond_templ() bad atom indexing 2
ERROR:: in add_link_bond_templ() bad atom indexing 1
ERROR:: in add_link_bond_templ() bad atom indexing 2
ERROR:: in add_link_bond_templ() bad atom indexing 1
ERROR:: in add_link_bond_templ() bad atom indexing 2
Minimum found (iteration number 81) at -772.6
    Final Estimated RMS Z Scores:
bonds:      2.445
angles:     2.348
torsions:   N/A 
planes:     1.537
non-bonded: 0.1026
chiral vol: 1.13
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
ERROR:: in add_link_bond_templ() bad atom indexing 1
ERROR:: in add_link_bond_templ() bad atom indexing 2
 SUCCESS
 TIME:: (dragged refinement): 57.22
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_pdb2qc1-sans-cho.pdb_Sat_Jan__6_07:46:50_2018_modification_3.pdb.gz
INFO:: replace_coords: 22 atoms updated.
INFO:: created 55 restraints

created 21 bond       restraints 
created 27 angle      restraints 
created 2 plane      restraints 
created 5 chiral vol restraints 
Link restraints: 
   1 bond    links
   2 angle   links
   1 plane   links
   0 trans-peptide links
   0 parallel plane restraints
Flanking residue restraints: 
   2 bond    links
   6 angle   links
   4 plane   links
   2 trans-peptide links
   0 parallel plane restraints
INFO:: make_restraints(): made 663 non-bonded restraints
ERROR:: in add_link_bond_templ() bad atom indexing 1
ERROR:: in add_link_bond_templ() bad atom indexing 2
initial distortion_score: -772.9
    Initial RMS Z values
bonds:      2.445
angles:     2.348
torsions:   N/A 
planes:     1.537
non-bonded: 0.1435
chiral vol: 1.13
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
ERROR:: in add_link_bond_templ() bad atom indexing 1
ERROR:: in add_link_bond_templ() bad atom indexing 2
Minimum found (iteration number 2) at -775.1
    Final Estimated RMS Z Scores:
bonds:      2.428
angles:     2.401
torsions:   N/A 
planes:     1.574
non-bonded: 0.14
chiral vol: 1.128
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
ERROR:: in add_link_bond_templ() bad atom indexing 1
ERROR:: in add_link_bond_templ() bad atom indexing 2
 SUCCESS
 TIME:: (dragged refinement): 57.34
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_pdb2qc1-sans-cho.pdb_Sat_Jan__6_07:46:50_2018_modification_4.pdb.gz
INFO:: replace_coords: 22 atoms updated.
PASS: Make a glycosidic linkage
Entered testcase - Refine an NAG-ASN Link
bond-length-within-tolerance? bond-length 1.6078360682322 with target 1.43 and tolerance 0.2 for atom ((" ND2" "") (1.0 16.9300003051758 " N" "") (-14.4715194702148 0.160089120268822 -7.36741018295288)) is ((" C1 " "") (1.0 45.0 " C" "") (-12.9937744140625 -0.326792687177658 -6.96200609207153))
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/monomer-VAL.pdb
 PDB file /lmb/home/pemsley/data/greg-data/monomer-VAL.pdb has been read.
Spacegroup: P 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 54 read successfully
DEBUG:: there were 0 types with no dictionary 
created 14 bond       restraints 
created 25 angle      restraints 
created 0 plane      restraints 
created 1 chiral vol restraints 
created 40 restraints

INFO:: make_restraints(): made 44 non-bonded restraints
initial distortion_score: 4.997
    Initial RMS Z values
bonds:      0.5425
angles:     0.1641
torsions:   N/A 
planes:     N/A 
non-bonded: 0
chiral vol: 0.4516
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 70) at 0.2482
    Final Estimated RMS Z Scores:
bonds:      0.01222
angles:     0.09486
torsions:   N/A 
planes:     N/A 
non-bonded: 0
chiral vol: 0.1454
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 61.21
debug:: restraints results 1 4 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_monomer-VAL.pdb_Sat_Jan__6_07:46:54_2018_modification_0.pdb.gz
INFO:: replace_coords: 15 atoms updated.
INFO:: undo molecule number set to: 54
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_monomer-VAL.pdb_Sat_Jan__6_07:46:54_2018_modification_1.pdb.gz
restoring from backup 2 2
INFO:: Reading coordinate file: coot-backup/_lmb_home_pemsley_data_greg-data_monomer-VAL.pdb_Sat_Jan__6_07:46:54_2018_modification_0.pdb.gz
 PDB file coot-backup/_lmb_home_pemsley_data_greg-data_monomer-VAL.pdb_Sat_Jan__6_07:46:54_2018_modification_0.pdb.gz has been read.
Spacegroup: P 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
DEBUG:: apply_undo: (end) history_index: 0 max_history_index: 2
created 14 bond       restraints 
created 25 angle      restraints 
created 0 plane      restraints 
created 1 chiral vol restraints 
created 40 restraints

INFO:: make_restraints(): made 44 non-bonded restraints
initial distortion_score: 4.997
    Initial RMS Z values
bonds:      0.5425
angles:     0.1641
torsions:   N/A 
planes:     N/A 
non-bonded: 0
chiral vol: 0.4516
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 70) at 0.2482
    Final Estimated RMS Z Scores:
bonds:      0.01222
angles:     0.09486
torsions:   N/A 
planes:     N/A 
non-bonded: 0
chiral vol: 0.1454
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 61.47
debug:: restraints results 1 4 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_monomer-VAL.pdb_Sat_Jan__6_07:46:55_2018_modification_0.pdb.gz
INFO:: replace_coords: 15 atoms updated.
PASS: Refine an NAG-ASN Link
Entered testcase - Test for flying hydrogens on undo
bond-length-within-tolerance? bond-length 0.960061691781605 with target 0.96 and tolerance 0.02 for atom (("HG11" "") (1.0 20.0 " H" "") (3.4704897403717 -0.190908700227737 -1.96913886070251)) is ((" CG1" "") (1.0 20.0 " C" "") (2.87013721466064 -0.207151547074318 -1.22011852264404))
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/3ins-6B-3.0-no-peptide-D.pdb
 PDB file /lmb/home/pemsley/data/greg-data/3ins-6B-3.0-no-peptide-D.pdb has been read.
No Spacegroup found for this PDB file
INFO:: Found 1 models
   Model 1 had 0 links
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 55 read successfully
DEBUG:: there were 0 types with no dictionary 
created 17 bond       restraints 
created 31 angle      restraints 
created 0 plane      restraints 
created 1 chiral vol restraints 
created 49 restraints

INFO:: make_restraints(): made 67 non-bonded restraints
initial distortion_score: 903.1
    Initial RMS Z values
bonds:      5.621
angles:     3.433
torsions:   N/A 
planes:     N/A 
non-bonded: 0
chiral vol: 0.7534
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 165) at 0.4747
    Final Estimated RMS Z Scores:
bonds:      0.009429
angles:     0.121
torsions:   N/A 
planes:     N/A 
non-bonded: 0
chiral vol: 0.1385
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 64.86
debug:: restraints results 1 4 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_3ins-6B-3.0-no-peptide-D.pdb_Sat_Jan__6_07:46:58_2018_modification_0.pdb.gz
INFO:: replace_coords: 18 atoms updated.
PASS: Test for flying hydrogens on undo
Entered testcase - Test for regularization and mangling of hydrogen names from a PDB v 3.0
bond-length-within-tolerance? bond-length 0.959993508181978 with target 0.96 and tolerance 0.02 for atom (("HD11" "") (1.0 10.5299997329712 " H" "") (-10.1156616210938 6.52059507369995 7.01407289505005)) is ((" CD1" "") (1.0 11.5200004577637 " C" "") (-10.1280078887939 5.64651441574097 6.61731338500977))
bond-length-within-tolerance? bond-length 0.96002780270247 with target 0.96 and tolerance 0.02 for atom (("HD12" "") (1.0 10.1300001144409 " H" "") (-9.7598762512207 5.68341684341431 5.73144054412842)) is ((" CD1" "") (1.0 11.5200004577637 " C" "") (-10.1280078887939 5.64651441574097 6.61731338500977))
bond-length-within-tolerance? bond-length 0.959946651623676 with target 0.96 and tolerance 0.02 for atom (("HD13" "") (1.0 10.5600004196167 " H" "") (-11.027907371521 5.31390428543091 6.58492517471313)) is ((" CD1" "") (1.0 11.5200004577637 " C" "") (-10.1280078887939 5.64651441574097 6.61731338500977))
bond-length-within-tolerance? bond-length 0.959995371308682 with target 0.96 and tolerance 0.02 for atom (("HD21" "") (1.0 10.1499996185303 " H" "") (-7.9939432144165 3.15288591384888 7.14437961578369)) is ((" CD2" "") (1.0 11.960000038147 " C" "") (-8.55896663665771 3.69613480567932 6.5901050567627))
bond-length-within-tolerance? bond-length 0.960016201142166 with target 0.96 and tolerance 0.02 for atom (("HD22" "") (1.0 10.3000001907349 " H" "") (-9.20783233642578 3.14652538299561 6.14453363418579)) is ((" CD2" "") (1.0 11.960000038147 " C" "") (-8.55896663665771 3.69613480567932 6.5901050567627))
bond-length-within-tolerance? bond-length 0.959897847605806 with target 0.96 and tolerance 0.02 for atom (("HD23" "") (1.0 10.6499996185303 " H" "") (-8.02846336364746 4.16698122024536 5.94336414337158)) is ((" CD2" "") (1.0 11.960000038147 " C" "") (-8.55896663665771 3.69613480567932 6.5901050567627))
created 11 bond       restraints 
created 15 angle      restraints 
created 1 plane      restraints 
created 1 chiral vol restraints 
created 28 restraints

INFO:: make_restraints(): made 39 non-bonded restraints
initial distortion_score: 2026
    Initial RMS Z values
bonds:      1.152
angles:     0.8476
torsions:   N/A 
planes:     3.056
non-bonded: 81.91
chiral vol: 0.7578
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 36) at -1103
    Final Estimated RMS Z Scores:
bonds:      0.8319
angles:     0.5953
torsions:   N/A 
planes:     0.5123
non-bonded: 0.08544
chiral vol: 0.266
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 64.97
Refinement elapsed time: 0.015
INFO:: backup file coot-backup/atom_selection_from_tutorial-modern.pdb_Sat_Jan__6_07:46:58_2018_modification_0.pdb.gz
INFO:: replace_coords: 12 atoms updated.
PASS: Test for regularization and mangling of hydrogen names from a PDB v 3.0
Entered testcase - correct matching dictionary names from test name
PASS: correct matching dictionary names from test name
Entered testcase - update monomer restraints
   Bond-length: 2.60349100511287: 
bond-length-within-tolerance? bond-length 2.60349100511287 with target 2.8 and tolerance 0.6 for atom ((" CB " "") (1.0 21.75 " C" "") (67.2706909179688 4.47352600097656 19.7667236328125)) is ((" CG " "") (1.0 21.9699993133545 " C" "") (68.5091171264648 6.66119050979614 19.0895309448242))
created 12 bond       restraints 
created 15 angle      restraints 
created 1 plane      restraints 
created 1 chiral vol restraints 
created 29 restraints

INFO:: make_restraints(): made 36 non-bonded restraints
initial distortion_score: 1355
    Initial RMS Z values
bonds:      14.34
angles:     0.5953
torsions:   N/A 
planes:     0.5123
non-bonded: 0
chiral vol: 0.266
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 56) at -1201
    Final Estimated RMS Z Scores:
bonds:      0.2962
angles:     0.2735
torsions:   N/A 
planes:     0.785
non-bonded: 0
chiral vol: 0.1532
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 65.05
Refinement elapsed time: 0.012
INFO:: backup file coot-backup/atom_selection_from_tutorial-modern.pdb_Sat_Jan__6_07:46:58_2018_modification_1.pdb.gz
INFO:: replace_coords: 12 atoms updated.
   pass intermediate 2.8 tolerance test
  OK plane atom " CB "
   Bond-length: 1.5179647157798: 
bond-length-within-tolerance? bond-length 1.5179647157798 with target 1.512 and tolerance 0.04 for atom ((" CB " "") (1.0 21.75 " C" "") (67.5530624389648 4.92009878158569 19.4121227264404)) is ((" CG " "") (1.0 21.9699993133545 " C" "") (68.3076477050781 6.2003698348999 19.1027297973633))
INFO:: wrote mmCIF "coot-test-ala.cif"
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/monomer-ACT.pdb
 PDB file /lmb/home/pemsley/data/greg-data/monomer-ACT.pdb has been read.
Spacegroup: P 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 57 read successfully
DEBUG:: there were 1 types with no dictionary 
Welcome to Coot
WARNING:: bond_restraint_length 4 should be 5
created 5 bond       restraints 
created 9 angle      restraints 
created 1 plane      restraints 
created 0 chiral vol restraints 
created 15 restraints

INFO:: make_restraints(): made 7 non-bonded restraints
initial distortion_score: 4849
    Initial RMS Z values
bonds:      0.01199
angles:     0.00654
torsions:   N/A 
planes:     0
non-bonded: 689.9
chiral vol: N/A 
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 134) at -295.2
    Final Estimated RMS Z Scores:
bonds:      0.0532
angles:     0.3713
torsions:   N/A 
planes:     0.07317
non-bonded: 0
chiral vol: N/A 
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
 SUCCESS
 TIME:: (dragged refinement): 69.23
Refinement elapsed time: 0.022
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_monomer-ACT.pdb_Sat_Jan__6_07:47:02_2018_modification_0.pdb.gz
INFO:: replace_coords: 7 atoms updated.
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 58 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:07_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:07_2018_modification_1.pdb.gz
INFO:: Removing CIS peptide from PDB header: A 26 A 27 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:07_2018_modification_2.pdb.gz
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:07_2018_modification_3.pdb.gz
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:07_2018_modification_4.pdb.gz
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:07_2018_modification_5.pdb.gz
INFO:: Removing CIS peptide from PDB header: B 26 B 27 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:07_2018_modification_6.pdb.gz
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:07_2018_modification_7.pdb.gz
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 59 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:11_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:11_2018_modification_1.pdb.gz
INFO:: NCS chain comparison 93/93
First atom of 720 in first  selection 1/A/1 {ASP}/ N   altLoc :: segid :: pos: (44.88,12.96,8.761) B-factor: 30.17
First atom of 745 in second selection 1/B/1 {ASP}/ N   altLoc :: segid :: pos: (13.88,16.17,23.03) B-factor: 20.03
INFO:: LSQ matched 93 atoms
INFO:: 93 matched atoms had: 
   mean devi: 1.179
    rms devi: 4.859
    max devi: 46.26
    min devi: 0.1254
   find_ncs_matrix returns (LSQ) 
|    0.9637,  -0.07462,   -0.2563|
|    0.2651,    0.3804,     0.886|
|    0.0314,   -0.9218,    0.3864|
(     38.09,    -17.87,     14.32)
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
INFO:: NCS chain comparison 93/93
First atom of 720 in first  selection 1/A/1 {ASP}/ N   altLoc :: segid :: pos: (44.88,12.96,8.761) B-factor: 30.17
First atom of 745 in second selection 1/B/1 {ASP}/ N   altLoc :: segid :: pos: (13.88,16.17,23.03) B-factor: 20.03
INFO:: LSQ matched 93 atoms
INFO:: 93 matched atoms had: 
   mean devi: 1.179
    rms devi: 4.859
    max devi: 46.26
    min devi: 0.1254
   find_ncs_matrix returns (LSQ) 
|    0.9637,  -0.07462,   -0.2563|
|    0.2651,    0.3804,     0.886|
|    0.0314,   -0.9218,    0.3864|
(     38.09,    -17.87,     14.32)
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
INFO:: backup file coot-backup/atom_selection_from_tutorial-modern.pdb_Sat_Jan__6_07:47:11_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/Copy_of__lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:11_2018_modification_0.pdb.gz
INFO:: replace_coords: 1465 atoms updated.
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 62 read successfully
DEBUG:: there were 0 types with no dictionary 
in new_molecule_by_residue_type_selection Something bad happened - No residues selected
in new_molecule_by_residue_type_selection Something bad happened - No residues selected
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:15_2018_modification_0.pdb.gz
oops! in rotamer::GetResidue() No tree in restraint
oops! in rotamer::GetResidue() No tree in restraint
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 63 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: [spec: 1 "A" 28 ""] [state: 1 name: "m-85" prob: 44%]
INFO:: [spec: 1 "A" 28 ""] [state: 1 name: "t80" prob: 33%]
INFO:: [spec: 1 "A" 28 ""] [state: 1 name: "p90" prob: 13%]
INFO:: [spec: 1 "A" 28 ""] [state: 1 name: "m -30 " prob: 9%]
INFO:: [spec: 1 "A" 28 ""] [state: 1 name: "m -30 " prob: 9%]
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/rnase-A-needs-an-insertion.pdb
 PDB file /lmb/home/pemsley/data/greg-data/rnase-A-needs-an-insertion.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 50/87
Molecule 64 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: aligning to mol number 64 chain: A

----- input to align_on_chain() -----------------
        chain A
        target DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLID
        wgap  -3
        is_nucleic_acid_flag 0
        console_output 1
---------------------------------------------------
INFO:: input model  sequence: GTVCLSAEATDTLNLIAASDGPFPYSSQDGVVFQNRESVLPTQSYGYYHEYTVITARTRGTRRIICGEATQEDYYTGDHYATFSLID
INFO:: input target sequence: DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLID
>  /lmb/home/pemsley/data/greg-data/rnase-A-needs-an-insertion.pdb
> target sequence:
   ---GTVCLSA---EATDTLNLIAASDGPFPYSSQDGVVFQNRESVLPTQSYGYYHEYTVIT--ARTRGTRRIICGEATQEDYYTGDHYATFSLID
      |||||||   ||||||||||  |||||||  |||||||||||||||||||||||||||  ||||||||||||||||||||||||||||||||
   DVSGTVCLSALPPEATDTLNLIAS-DGPFPYSQ-DGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLID
INFO:: alignment score 150
DEBUG:: s.length() 95
DEBUG:: nSelResidues 87
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_rnase-A-needs-an-insertion.pdb_Sat_Jan__6_07:47:24_2018_modification_0.pdb.gz
INFO:: Removing CIS peptide from PDB header: A 26 A 27 
The alignment resulted in the following
   Insertions (coalesced):
       from 1 to 4 ASP VAL SER 
       from 11 to 14 LEU PRO PRO 
       from 62 to 64 PRO GLY 
   Insertions (singles):
      [spec: 98553288 "A" 1 ""] -> ASP
      [spec: 98553288 "A" 2 ""] -> VAL
      [spec: 98553288 "A" 3 ""] -> SER
      [spec: 98553288 "A" 11 ""] -> LEU
      [spec: 98553288 "A" 12 ""] -> PRO
      [spec: 98553288 "A" 13 ""] -> PRO
      [spec: 98553288 "A" 62 ""] -> PRO
      [spec: 98553288 "A" 63 ""] -> GLY
   Deletions:
      [spec: 98553288 "A" 25 ""]
      [spec: 98553288 "A" 34 ""]
   Mutations:
      [spec: 98553288 "A" 24 ""] -> SER
      [spec: 98553288 "A" 33 ""] -> GLN
INFO:: mutate 24 A to a SER
INFO:: mutate 33 A to a GLN
apply resno updates... 
Applied 3 insertions 
Applied 2 mutations 
Applied 2 deletions 
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 65 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:27_2018_modification_0.pdb.gz
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 66 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:31_2018_modification_0.pdb.gz
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/pdb3hfl.ent
 PDB file /lmb/home/pemsley/data/greg-data/pdb3hfl.ent has been read.
No Spacegroup found for this PDB file
INFO:: Found 1 models
   Model 1 had 0 links
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 15/212
INFO:: NCS chain comparison 7/212
INFO:: NCS chain comparison 10/215
Molecule 67 read successfully
DEBUG:: there were 1 types with no dictionary 
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/3hfl_sigmaa.mtz
Number of OBSERVED reflections: 17920
INFO:: finding ASU unique map points with sampling rate 1.5
INFO grid sampling...Nuvw = (  64,  96,  90)
INFO:: 0.022 seconds to read MTZ file
INFO:: 0.008 seconds to initialize map
INFO:: 0.015 seconds for FFT
INFO:: 0.004 seconds for statistics
      Map mean: ........ 7.462e-11
      Map sigma: ....... 0.2604
      Map maximum: ..... 1.718
      Map minimum: ..... -1.034
INFO:: 0.033 seconds for contour map
INFO:: 0.082 seconds in total
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_pdb3hfl.ent_Sat_Jan__6_07:47:35_2018_modification_0.pdb.gz
INFO:: replace_coords: 7 atoms updated.
Fitting score for best rotamer: 5.834
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_pdb3hfl.ent_Sat_Jan__6_07:47:35_2018_modification_1.pdb.gz
INFO:: 5 matched atoms had: 
   mean devi: 0
    rms devi: 0
    max devi: 0
    min devi: 0
INFO:: 5 matched atoms had: 
   mean devi: 0.01207
    rms devi: 0.01345
    max devi: 0.02142
    min devi: 0.003856
INFO:: 5 matched atoms had: 
   mean devi: 0.2702
    rms devi: 0.335
    max devi: 0.536
    min devi: 0.08463
INFO:: 5 matched atoms had: 
   mean devi: 0.2674
    rms devi: 0.3228
    max devi: 0.4951
    min devi: 0.1123
INFO:: 5 matched atoms had: 
   mean devi: 0.2702
    rms devi: 0.335
    max devi: 0.536
    min devi: 0.0847
INFO:: 5 matched atoms had: 
   mean devi: 0.2674
    rms devi: 0.3228
    max devi: 0.4952
    min devi: 0.1122
INFO:: 5 matched atoms had: 
   mean devi: 0.01198
    rms devi: 0.01335
    max devi: 0.02126
    min devi: 0.003873
INFO:: 5 matched atoms had: 
   mean devi: 0.0002426
    rms devi: 0.0002428
    max devi: 0.0002567
    min devi: 0.0002313
INFO:: 5 matched atoms had: 
   mean devi: 0.2702
    rms devi: 0.335
    max devi: 0.536
    min devi: 0.08456
INFO:: 5 matched atoms had: 
   mean devi: 0.2673
    rms devi: 0.3228
    max devi: 0.4951
    min devi: 0.1124
INFO:: 5 matched atoms had: 
   mean devi: 6.931e-05
    rms devi: 6.936e-05
    max devi: 7.334e-05
    min devi: 6.608e-05
INFO:: 5 matched atoms had: 
   mean devi: 0.01203
    rms devi: 0.01341
    max devi: 0.02135
    min devi: 0.003862
INFO:: 5 matched atoms had: 
   mean devi: 0.0001386
    rms devi: 0.0001387
    max devi: 0.0001467
    min devi: 0.0001322
INFO:: 5 matched atoms had: 
   mean devi: 0.012
    rms devi: 0.01337
    max devi: 0.02129
    min devi: 0.003869
INFO:: 5 matched atoms had: 
   mean devi: 0.2674
    rms devi: 0.3228
    max devi: 0.4952
    min devi: 0.1122
INFO:: 5 matched atoms had: 
   mean devi: 0.2703
    rms devi: 0.3351
    max devi: 0.5361
    min devi: 0.08481
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
INFO:: NCS chain comparison 0/8
INFO:: backup file coot-backup/Ideal-A-form-RNA_Sat_Jan__6_07:47:36_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/Ideal-A-form-RNA_Sat_Jan__6_07:47:36_2018_modification_1.pdb.gz
INFO:: 5 matched atoms had: 
   mean devi: 0.269
    rms devi: 0.3372
    max devi: 0.5475
    min devi: 0.08176
INFO:: 5 matched atoms had: 
   mean devi: 0
    rms devi: 0
    max devi: 0
    min devi: 0
INFO:: 5 matched atoms had: 
   mean devi: 0.01207
    rms devi: 0.01345
    max devi: 0.02142
    min devi: 0.003856
INFO:: 5 matched atoms had: 
   mean devi: 0.2702
    rms devi: 0.335
    max devi: 0.536
    min devi: 0.08463
INFO:: 5 matched atoms had: 
   mean devi: 0.2674
    rms devi: 0.3228
    max devi: 0.4951
    min devi: 0.1123
INFO:: 5 matched atoms had: 
   mean devi: 0.2702
    rms devi: 0.335
    max devi: 0.536
    min devi: 0.0847
INFO:: 5 matched atoms had: 
   mean devi: 0.2674
    rms devi: 0.3228
    max devi: 0.4952
    min devi: 0.1122
INFO:: 5 matched atoms had: 
   mean devi: 0.01198
    rms devi: 0.01335
    max devi: 0.02126
    min devi: 0.003873
INFO:: 5 matched atoms had: 
   mean devi: 0.0002426
    rms devi: 0.0002428
    max devi: 0.0002567
    min devi: 0.0002313
INFO:: 5 matched atoms had: 
   mean devi: 0.2702
    rms devi: 0.335
    max devi: 0.536
    min devi: 0.08456
INFO:: 5 matched atoms had: 
   mean devi: 0.2673
    rms devi: 0.3228
    max devi: 0.4951
    min devi: 0.1124
INFO:: 5 matched atoms had: 
   mean devi: 6.931e-05
    rms devi: 6.936e-05
    max devi: 7.334e-05
    min devi: 6.608e-05
INFO:: 5 matched atoms had: 
   mean devi: 0.01203
    rms devi: 0.01341
    max devi: 0.02135
    min devi: 0.003862
INFO:: 5 matched atoms had: 
   mean devi: 0.0001386
    rms devi: 0.0001387
    max devi: 0.0001467
    min devi: 0.0001322
INFO:: 5 matched atoms had: 
   mean devi: 0.012
    rms devi: 0.01337
    max devi: 0.02129
    min devi: 0.003869
INFO:: 5 matched atoms had: 
   mean devi: 0.2674
    rms devi: 0.3228
    max devi: 0.4952
    min devi: 0.1122
INFO:: 5 matched atoms had: 
   mean devi: 0.2703
    rms devi: 0.3351
    max devi: 0.5361
    min devi: 0.08481
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
INFO:: NCS chain comparison 0/8
INFO:: backup file coot-backup/Ideal-A-form-RNA_Sat_Jan__6_07:47:36_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/Ideal-A-form-RNA_Sat_Jan__6_07:47:36_2018_modification_1.pdb.gz
INFO:: 5 matched atoms had: 
   mean devi: 0.269
    rms devi: 0.3372
    max devi: 0.5475
    min devi: 0.08176
INFO:: 5 matched atoms had: 
   mean devi: 0.005899
    rms devi: 0.00671
    max devi: 0.01013
    min devi: 0.002581
INFO:: 5 matched atoms had: 
   mean devi: 0.007256
    rms devi: 0.007788
    max devi: 0.01256
    min devi: 0.00456
INFO:: 5 matched atoms had: 
   mean devi: 0.2718
    rms devi: 0.3364
    max devi: 0.5338
    min devi: 0.08783
INFO:: 5 matched atoms had: 
   mean devi: 0.2678
    rms devi: 0.3265
    max devi: 0.5056
    min devi: 0.1046
INFO:: 5 matched atoms had: 
   mean devi: 0.2718
    rms devi: 0.3364
    max devi: 0.5339
    min devi: 0.0879
INFO:: 5 matched atoms had: 
   mean devi: 0.2678
    rms devi: 0.3265
    max devi: 0.5056
    min devi: 0.1045
INFO:: 5 matched atoms had: 
   mean devi: 0.007179
    rms devi: 0.0077
    max devi: 0.01241
    min devi: 0.004575
INFO:: 5 matched atoms had: 
   mean devi: 0.005744
    rms devi: 0.006571
    max devi: 0.009959
    min devi: 0.002425
INFO:: 5 matched atoms had: 
   mean devi: 0.2718
    rms devi: 0.3364
    max devi: 0.5338
    min devi: 0.08776
INFO:: 5 matched atoms had: 
   mean devi: 0.2677
    rms devi: 0.3265
    max devi: 0.5055
    min devi: 0.1047
INFO:: 5 matched atoms had: 
   mean devi: 0.005854
    rms devi: 0.006669
    max devi: 0.01008
    min devi: 0.002535
INFO:: 5 matched atoms had: 
   mean devi: 0.007225
    rms devi: 0.007753
    max devi: 0.0125
    min devi: 0.004565
INFO:: 5 matched atoms had: 
   mean devi: 0.00581
    rms devi: 0.006629
    max devi: 0.01003
    min devi: 0.00249
INFO:: 5 matched atoms had: 
   mean devi: 0.007194
    rms devi: 0.007718
    max devi: 0.01244
    min devi: 0.004572
INFO:: 5 matched atoms had: 
   mean devi: 0.2678
    rms devi: 0.3266
    max devi: 0.5056
    min devi: 0.1045
INFO:: 5 matched atoms had: 
   mean devi: 0.2719
    rms devi: 0.3365
    max devi: 0.5339
    min devi: 0.08801
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
INFO:: NCS chain comparison 0/8
INFO:: backup file coot-backup/Ideal-A-form-DNA_Sat_Jan__6_07:47:36_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/Ideal-A-form-DNA_Sat_Jan__6_07:47:36_2018_modification_1.pdb.gz
INFO:: 5 matched atoms had: 
   mean devi: 0.2702
    rms devi: 0.3364
    max devi: 0.5384
    min devi: 0.0854
INFO:: backup file coot-backup/Ideal-A-form-DNA_Sat_Jan__6_07:47:36_2018_modification_2.pdb.gz
INFO:: 5 matched atoms had: 
   mean devi: 0.2719
    rms devi: 0.3363
    max devi: 0.5345
    min devi: 0.09235
INFO:: backup file coot-backup/Ideal-A-form-DNA_Sat_Jan__6_07:47:36_2018_modification_3.pdb.gz
INFO:: 5 matched atoms had: 
   mean devi: 0.004329
    rms devi: 0.004818
    max devi: 0.007383
    min devi: 0.001862
INFO:: backup file coot-backup/Ideal-A-form-DNA_Sat_Jan__6_07:47:36_2018_modification_4.pdb.gz
INFO:: 5 matched atoms had: 
   mean devi: 0.2657
    rms devi: 0.326
    max devi: 0.5019
    min devi: 0.09266
INFO:: 5 matched atoms had: 
   mean devi: 0.005899
    rms devi: 0.00671
    max devi: 0.01013
    min devi: 0.002581
INFO:: 5 matched atoms had: 
   mean devi: 0.007256
    rms devi: 0.007788
    max devi: 0.01256
    min devi: 0.00456
INFO:: 5 matched atoms had: 
   mean devi: 0.2718
    rms devi: 0.3364
    max devi: 0.5338
    min devi: 0.08783
INFO:: 5 matched atoms had: 
   mean devi: 0.2678
    rms devi: 0.3265
    max devi: 0.5056
    min devi: 0.1046
INFO:: 5 matched atoms had: 
   mean devi: 0.2718
    rms devi: 0.3364
    max devi: 0.5339
    min devi: 0.0879
INFO:: 5 matched atoms had: 
   mean devi: 0.2678
    rms devi: 0.3265
    max devi: 0.5056
    min devi: 0.1045
INFO:: 5 matched atoms had: 
   mean devi: 0.007179
    rms devi: 0.0077
    max devi: 0.01241
    min devi: 0.004575
INFO:: 5 matched atoms had: 
   mean devi: 0.005744
    rms devi: 0.006571
    max devi: 0.009959
    min devi: 0.002425
INFO:: 5 matched atoms had: 
   mean devi: 0.2718
    rms devi: 0.3364
    max devi: 0.5338
    min devi: 0.08776
INFO:: 5 matched atoms had: 
   mean devi: 0.2677
    rms devi: 0.3265
    max devi: 0.5055
    min devi: 0.1047
INFO:: 5 matched atoms had: 
   mean devi: 0.005854
    rms devi: 0.006669
    max devi: 0.01008
    min devi: 0.002535
INFO:: 5 matched atoms had: 
   mean devi: 0.007225
    rms devi: 0.007753
    max devi: 0.0125
    min devi: 0.004565
INFO:: 5 matched atoms had: 
   mean devi: 0.00581
    rms devi: 0.006629
    max devi: 0.01003
    min devi: 0.00249
INFO:: 5 matched atoms had: 
   mean devi: 0.007194
    rms devi: 0.007718
    max devi: 0.01244
    min devi: 0.004572
INFO:: 5 matched atoms had: 
   mean devi: 0.2678
    rms devi: 0.3266
    max devi: 0.5056
    min devi: 0.1045
INFO:: 5 matched atoms had: 
   mean devi: 0.2719
    rms devi: 0.3365
    max devi: 0.5339
    min devi: 0.08801
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
INFO:: NCS chain comparison 0/8
INFO:: backup file coot-backup/Ideal-A-form-DNA_Sat_Jan__6_07:47:36_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/Ideal-A-form-DNA_Sat_Jan__6_07:47:36_2018_modification_1.pdb.gz
INFO:: 5 matched atoms had: 
   mean devi: 0.2702
    rms devi: 0.3364
    max devi: 0.5384
    min devi: 0.0854
INFO:: backup file coot-backup/Ideal-A-form-DNA_Sat_Jan__6_07:47:36_2018_modification_2.pdb.gz
INFO:: 5 matched atoms had: 
   mean devi: 0.2719
    rms devi: 0.3363
    max devi: 0.5345
    min devi: 0.09235
INFO:: backup file coot-backup/Ideal-A-form-DNA_Sat_Jan__6_07:47:36_2018_modification_3.pdb.gz
INFO:: 5 matched atoms had: 
   mean devi: 0.004329
    rms devi: 0.004818
    max devi: 0.007383
    min devi: 0.001862
INFO:: backup file coot-backup/Ideal-A-form-DNA_Sat_Jan__6_07:47:36_2018_modification_4.pdb.gz
INFO:: 5 matched atoms had: 
   mean devi: 0.2657
    rms devi: 0.326
    max devi: 0.5019
    min devi: 0.09266
INFO:: NCS chain comparison 93/93
First atom of 720 in first  selection 1/A/1 {ASP}/ N   altLoc :: segid :: pos: (44.88,12.96,8.761) B-factor: 30.17
First atom of 745 in second selection 1/B/1 {ASP}/ N   altLoc :: segid :: pos: (13.88,16.17,23.03) B-factor: 20.03
INFO:: LSQ matched 93 atoms
INFO:: 93 matched atoms had: 
   mean devi: 1.179
    rms devi: 4.859
    max devi: 46.26
    min devi: 0.1254
   find_ncs_matrix returns (LSQ) 
|    0.9637,  -0.07462,   -0.2563|
|    0.2651,    0.3804,     0.886|
|    0.0314,   -0.9218,    0.3864|
(     38.09,    -17.87,     14.32)
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
INFO:: mutate 32 A to a LYS
INFO:: backup file coot-backup/Copy_of__lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:37_2018_modification_0.pdb.gz
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/some-waters-with-ter.pdb
 PDB file /lmb/home/pemsley/data/greg-data/some-waters-with-ter.pdb has been read.
No Spacegroup found for this PDB file
INFO:: Found 1 models
   Model 1 had 0 links
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 74 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_some-waters-with-ter.pdb_Sat_Jan__6_07:47:41_2018_modification_0.pdb.gz
1/D/79 {HOH}/ O   altLoc :: segid :: pos: (3,4,5) B-factor: 45 added to molecule
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tm+some-waters.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tm+some-waters.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 75 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: Protein centre at: xyz = (     41.57,     8.745,     12.89)
using sigma cut off 2
Calling lig.water_fit()
INFO:: find_clusters map_rms is 0.3115
INFO:: Using density cut-off: 0.623 (2 sigma)  (mean -0.03382 stdev: 0.1462)
INFO:: Blobs with volume larger than 11 A^3 are too big to be considered waters.
INFO:: Using water to protein distance limits: 2.4 3.2
INFO:: Finding clusters...done
-------------------------------------------------------------
INFO:: cluster at xyz = (     59.88,     3.015,    -4.288) is too big to be water
INFO:: cluster at xyz = (     70.02,     19.08,     18.63) is too big to be water
INFO:: cluster at xyz = (        53,     9.031,     20.13) is too big to be water
INFO:: found 59 waters in water fitting
Done - back from lig.water_fit()
DEBUG::  new_waters_mol_flag: 0
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tm+some-waters.pdb_Sat_Jan__6_07:47:45_2018_modification_0.pdb.gz
INFO:: Adding to solvent chain: D
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 76 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_0.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_1.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_2.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_3.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_4.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_5.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_6.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_7.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_8.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_9.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_10.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_11.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_12.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_13.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_14.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_15.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_16.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_17.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_18.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_19.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_20.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_21.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_22.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_23.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_24.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_25.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_26.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_27.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_28.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_29.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_30.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_31.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_32.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_33.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_34.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_35.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_36.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_37.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_38.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_39.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_40.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_41.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_42.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_43.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_44.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_45.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_46.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_47.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_48.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_49.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_50.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_51.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_52.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_53.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_54.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_55.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_56.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_57.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_58.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_59.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_60.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_61.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_62.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_63.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_64.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_65.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_66.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_67.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_68.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_69.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_70.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_71.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_72.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_73.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_74.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_75.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_76.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_77.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_78.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_79.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_80.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_81.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_82.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_83.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_84.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_85.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_86.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_87.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_88.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_89.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_90.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_91.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_92.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_93.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_94.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_95.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_96.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_97.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_98.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:47:49_2018_modification_99.pdb.gz
0//-32767 {MG}/MG   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/water-test-no-cell.pdb
 PDB file /lmb/home/pemsley/data/greg-data/water-test-no-cell.pdb has been read.
No Spacegroup found for this PDB file
INFO:: Found 1 models
   Model 1 had 0 links
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 77 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_water-test-no-cell.pdb_Sat_Jan__6_07:48:00_2018_modification_0.pdb.gz
No symmetry available
INFO:: moved 0 water molecules
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/pathological-water-test.pdb
 PDB file /lmb/home/pemsley/data/greg-data/pathological-water-test.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 78 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_pathological-water-test.pdb_Sat_Jan__6_07:48:03_2018_modification_0.pdb.gz
INFO:: moved 181 water molecules
INFO:: NCS chain comparison 93/93
First atom of 720 in first  selection 1/A/1 {ASP}/ N   altLoc :: segid :: pos: (44.88,12.96,8.761) B-factor: 30.17
First atom of 745 in second selection 1/B/1 {ASP}/ N   altLoc :: segid :: pos: (13.88,16.17,23.03) B-factor: 20.03
INFO:: LSQ matched 93 atoms
INFO:: 93 matched atoms had: 
   mean devi: 1.179
    rms devi: 4.859
    max devi: 46.26
    min devi: 0.1254
   find_ncs_matrix returns (LSQ) 
|    0.9637,  -0.07462,   -0.2563|
|    0.2651,    0.3804,     0.886|
|    0.0314,   -0.9218,    0.3864|
(     38.09,    -17.87,     14.32)
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 1.5
INFO grid sampling...Nuvw = ( 108, 132,  64)
INFO:: 0.032 seconds to read MTZ file
INFO:: 0.001 seconds to initialize map
INFO:: 0.023 seconds for FFT
INFO:: 0.003 seconds for statistics
      Map mean: ........ 1.041e-09
      Map sigma: ....... 0.3115
      Map maximum: ..... 2.978
      Map minimum: ..... -0.875
INFO:: 0.109 seconds for contour map
INFO:: 0.168 seconds in total
fitting terminal residue with 1000 random trials
                     called fit_terminal_residue_generic() residue-seqnum: 93 offset: 1
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
DEBUG:: oops residue subject_res_num 92 - No atoms
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
INFO:: mutating residue in add_cb_to_terminal_res
INFO:: backup file coot-backup/Copy_of__lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:48:04_2018_modification_0.pdb.gz
INFO:: NCS chain comparison 93/93
First atom of 720 in first  selection 1/A/1 {ASP}/ N   altLoc :: segid :: pos: (44.88,12.96,8.761) B-factor: 30.17
First atom of 745 in second selection 1/B/1 {ASP}/ N   altLoc :: segid :: pos: (13.88,16.17,23.03) B-factor: 20.03
INFO:: LSQ matched 93 atoms
INFO:: 93 matched atoms had: 
   mean devi: 1.179
    rms devi: 4.859
    max devi: 46.26
    min devi: 0.1254
   find_ncs_matrix returns (LSQ) 
|    0.9637,  -0.07462,   -0.2563|
|    0.2651,    0.3804,     0.886|
|    0.0314,   -0.9218,    0.3864|
(     38.09,    -17.87,     14.32)
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
DEBUG ncs_control_change_ncs_master_to_chain_update_widget imol: 81 and ichain: 0
DEBUG:: ncs_control_change_ncs_master_to_chain imol: 81 and ichain: 0
   %%%%%% add_ncs_ghosts_using_ncs_master 
   %%%%%% imaster: 0
   Checking chains for NCS matching to chain A
INFO:: NCS chain comparison 93/93
First atom of 720 in first  selection 1/A/1 {ASP}/ N   altLoc :: segid :: pos: (44.88,12.96,8.761) B-factor: 30.17
First atom of 745 in second selection 1/B/1 {ASP}/ N   altLoc :: segid :: pos: (13.88,16.17,23.03) B-factor: 20.03
INFO:: LSQ matched 93 atoms
INFO:: 93 matched atoms had: 
   mean devi: 1.179
    rms devi: 4.859
    max devi: 46.26
    min devi: 0.1254
   find_ncs_matrix returns (LSQ) 
|    0.9637,  -0.07462,   -0.2563|
|    0.2651,    0.3804,     0.886|
|    0.0314,   -0.9218,    0.3864|
(     38.09,    -17.87,     14.32)
   Adding ghost with name: NCS found from matching Chain B onto Chain A
INFO:: set_ncs_master_chain Constructed 1 ghosts
   Ghost info:: NCS found from matching Chain B onto Chain A
INFO:: backup file coot-backup/Copy_of__lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:48:04_2018_modification_0.pdb.gz
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 82 read successfully
DEBUG:: there were 0 types with no dictionary 
0//-32767 {HOH}/ O   altLoc :: segid :: pos: (41.6,8.687,12.91) B-factor: 45 added to molecule (and new chain)
1/C/2 {HOH}/ O   altLoc :: segid :: pos: (43.6,8.687,12.91) B-factor: 45 added to molecule
1/C/3 {HOH}/ O   altLoc :: segid :: pos: (45.6,8.687,12.91) B-factor: 45 added to molecule
1/C/4 {HOH}/ O   altLoc :: segid :: pos: (47.6,8.687,12.91) B-factor: 45 added to molecule
1/C/5 {HOH}/ O   altLoc :: segid :: pos: (49.6,8.687,12.91) B-factor: 45 added to molecule
1/D/16 {HOH}/ O   altLoc :: segid :: pos: (51.6,8.687,12.91) B-factor: 45 added to molecule
1/D/17 {HOH}/ O   altLoc :: segid :: pos: (53.6,8.687,12.91) B-factor: 45 added to molecule
1/D/18 {HOH}/ O   altLoc :: segid :: pos: (55.6,8.687,12.91) B-factor: 45 added to molecule
1/D/19 {HOH}/ O   altLoc :: segid :: pos: (57.6,8.687,12.91) B-factor: 45 added to molecule
1/D/20 {HOH}/ O   altLoc :: segid :: pos: (59.6,8.687,12.91) B-factor: 45 added to molecule
1/D/21 {HOH}/ O   altLoc :: segid :: pos: (61.6,8.687,12.91) B-factor: 45 added to molecule
1/D/22 {HOH}/ O   altLoc :: segid :: pos: (63.6,8.687,12.91) B-factor: 45 added to molecule
1/D/23 {HOH}/ O   altLoc :: segid :: pos: (65.6,8.687,12.91) B-factor: 45 added to molecule
1/D/24 {HOH}/ O   altLoc :: segid :: pos: (67.6,8.687,12.91) B-factor: 45 added to molecule
1/D/25 {HOH}/ O   altLoc :: segid :: pos: (69.6,8.687,12.91) B-factor: 45 added to molecule
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/pdb1hvv.ent
 PDB file /lmb/home/pemsley/data/greg-data/pdb1hvv.ent has been read.
Spacegroup: P 31 2 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 1 biomt matrices
INFO:: NCS chain comparison 62/67
INFO:: NCS chain comparison 66/67
INFO:: NCS chain comparison 61/67
INFO:: NCS chain comparison 0/67
  INFO:: fill_ghost_info Constructed 3 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
      Ghost 1 name: "NCS found from matching Chain C onto Chain A"
      Ghost 2 name: "NCS found from matching Chain D onto Chain A"
Molecule 83 read successfully
DEBUG:: there were 1 types with no dictionary 
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/monomer-ACT.pdb
 PDB file /lmb/home/pemsley/data/greg-data/monomer-ACT.pdb has been read.
Spacegroup: P 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 84 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/monomer-NPO.pdb
 PDB file /lmb/home/pemsley/data/greg-data/monomer-NPO.pdb has been read.
Spacegroup: P 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 85 read successfully
DEBUG:: there were 1 types with no dictionary 
-X,-X+Y,-Z+1/3 ->
-1 0 0
-1 1 0
0 0 -1
translations: 0 0 0.3333
pre-trans: 0 0 0
INFO:: NCS chain comparison 62/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (62.57,-20.5,95.47) B-factor: 45.26
First atom of 506 in second selection 1/B/193 {SER}/ N   altLoc :: segid :: pos: (64.42,-37.85,121.4) B-factor: 88.52
INFO:: LSQ matched 62 atoms
INFO:: 62 matched atoms had: 
   mean devi: 2.499
    rms devi: 2.796
    max devi: 6.686
    min devi: 0.4401
   find_ncs_matrix returns (LSQ) 
|    0.8045,     0.069,      0.59|
|    0.5435,     0.315,    -0.778|
|   -0.2395,    0.9466,    0.2159|
(    -57.32,     43.57,     131.4)
INFO:: NCS chain comparison 66/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (62.57,-20.5,95.47) B-factor: 45.26
First atom of 535 in second selection 1/C/190 {GLN}/ N   altLoc :: segid :: pos: (-18.26,-63.04,111.4) B-factor: 50.76
INFO:: LSQ matched 66 atoms
INFO:: 66 matched atoms had: 
   mean devi: 1.971
    rms devi: 2.173
    max devi: 4.541
    min devi: 0.4295
   find_ncs_matrix returns (LSQ) 
|   -0.5596,   -0.8266,   0.06065|
|   -0.8239,    0.5468,   -0.1492|
|   0.09015,   -0.1334,   -0.9869|
(    -4.436,     16.92,     204.3)
INFO:: NCS chain comparison 61/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (62.57,-20.5,95.47) B-factor: 45.26
First atom of 497 in second selection 1/D/193 {SER}/ N   altLoc :: segid :: pos: (-0.2911,-72.48,94.47) B-factor: 78.35
INFO:: LSQ matched 61 atoms
INFO:: 61 matched atoms had: 
   mean devi: 3.704
    rms devi: 4.086
    max devi: 9.438
    min devi: 0.2858
   find_ncs_matrix returns (LSQ) 
|   -0.4782,   -0.7381,    -0.476|
|   -0.7473,   0.05733,     0.662|
|   -0.4613,    0.6723,    -0.579|
(     53.45,    -87.51,     210.2)
INFO:: NCS chain comparison 0/67
INFO:: NCS chain comparison 0/67
INFO:: NCS chain comparison 0/67
INFO:: NCS chain comparison 0/54
INFO:: NCS chain comparison 0/54
INFO:: NCS chain comparison 0/1
  INFO:: fill_ghost_info Constructed 3 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
      Ghost 1 name: "NCS found from matching Chain C onto Chain A"
      Ghost 2 name: "NCS found from matching Chain D onto Chain A"
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 87 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:48:24_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/atom_selection_from_tutorial-modern.pdb_Sat_Jan__6_07:48:24_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/atom_selection_from_tutorial-modern.pdb_Sat_Jan__6_07:48:24_2018_modification_1.pdb.gz
INFO:: NCS chain comparison 93/93
First atom of 720 in first  selection 1/A/1 {ASP}/ N   altLoc :: segid :: pos: (44.88,12.96,8.761) B-factor: 30.17
First atom of 745 in second selection 1/B/1 {ASP}/ N   altLoc :: segid :: pos: (13.88,16.17,23.03) B-factor: 20.03
INFO:: LSQ matched 93 atoms
INFO:: 93 matched atoms had: 
   mean devi: 1.179
    rms devi: 4.859
    max devi: 46.26
    min devi: 0.1254
   find_ncs_matrix returns (LSQ) 
|    0.9637,  -0.07462,   -0.2563|
|    0.2651,    0.3804,     0.886|
|    0.0314,   -0.9218,    0.3864|
(     38.09,    -17.87,     14.32)
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
INFO:: NCS chain comparison 93/93
First atom of 720 in first  selection 1/A/1 {ASP}/ N   altLoc :: segid :: pos: (44.88,12.96,8.761) B-factor: 30.17
First atom of 745 in second selection 1/B/1 {ASP}/ N   altLoc :: segid :: pos: (13.88,16.17,23.03) B-factor: 20.03
INFO:: LSQ matched 93 atoms
INFO:: 93 matched atoms had: 
   mean devi: 1.179
    rms devi: 4.859
    max devi: 46.26
    min devi: 0.1254
   find_ncs_matrix returns (LSQ) 
|    0.9637,  -0.07462,   -0.2563|
|    0.2651,    0.3804,     0.886|
|    0.0314,   -0.9218,    0.3864|
(     38.09,    -17.87,     14.32)
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
INFO:: Matching/moving molecule number 90 to 89
INFO:: LSQ matched 4 atoms
INFO:: 4 matched atoms had: 
   mean devi: 0.03532
    rms devi: 0.03779
    max devi: 0.05453
    min devi: 0.01668
INFO:: Axis orientation: (    0.9786,    0.1755,   -0.1076)
INFO:: Rotation in CCP4 Polar Angles: Polar = (83.8253,-169.833,67.7313)
INFO:: backup file coot-backup/Copy_of__lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:48:24_2018_modification_0.pdb.gz
INFO:: coordinates transformed by orthogonal matrix: 
|    0.9737,  0.007115,   -0.2278|
|    0.2062,    0.3981,    0.8939|
|   0.09703,   -0.9173,    0.3861|
(     37.45,     -16.6,     12.88)
INFO:: fractional coordinates matrix:
|    0.9737,  0.008587,   -0.1361|
|    0.1708,    0.3981,    0.4427|
|    0.1623,    -1.852,    0.3861|
(     0.577,   -0.2119,    0.3319)
PASS: update monomer restraints
Entered testcase - Write mmCIF restraints correctly
PASS: Write mmCIF restraints correctly
Entered testcase - Refinement OK with zero bond esd
PASS: Refinement OK with zero bond esd
Entered testcase - Change Chain IDs and Chain Sorting
PASS: Change Chain IDs and Chain Sorting
Entered testcase - Chain-ids in links change also on change chain id
PASS: Chain-ids in links change also on change chain id
Entered testcase - Replace Fragment
   distances: (20.8326663813327 20.8326666331108 20.8326661982214 20.8326666331108 20.8326663813327)
PASS: Replace Fragment
Entered testcase - Residues in Region of Residue
   found 6 neighbours (("B" 60 "") ("A" 42 "") ("B" 61 "") ("A" 38 "") ("A" 41 "") ("A" 39 ""))
   found 0 neighbours ()
PASS: Residues in Region of Residue
Entered testcase - Residues in region of a point
PASS: Residues in region of a point
Entered testcase - Empty molecule on type selection
PASS: Empty molecule on type selection
Entered testcase - Set Rotamer
PASS: Set Rotamer
Entered testcase - Rotamer names and scores are correct
   Rotamer 0 : "m-85" 100.0 
   Rotamer 1 : "t80" 90.1668395996094 
   Rotamer 2 : "p90" 50.7077865600586 
   Rotamer 3 : "m -30 " 21.4231548309326 
   Rotamer 4 : "m -30 " 21.4231548309326 
PASS: Rotamer names and scores are correct
Entered testcase - Align and mutate a model with deletions
    ::::: (64 "A" 1 "") #f #f
    ::::: (64 "A" 4 "") #t #t
    ::::: (64 "A" 57 "") #t #t
    ::::: (64 "A" 60 "") #f #f
    ::::: (64 "A" 61 "") #f #f
    ::::: (64 "A" 92 "") #t #t
    ::::: (64 "A" 94 "") #f #f
results: (#t #t #t #t #t #t #t)
PASS: Align and mutate a model with deletions
Entered testcase - renumbered residues should be in seqnum order
PASS: renumbered residues should be in seqnum order
Entered testcase - Autofit Rotamer on Residues with Insertion codes
PASS: Autofit Rotamer on Residues with Insertion codes
Entered testcase - RNA base has correct residue type after mutation
  mutated base to type "C" - was "A" 
  mutated base to type "Cr" - was "A" 
PASS: RNA base has correct residue type after mutation
Entered testcase - resname from serial number doesnt crash on silly input
PASS: resname from serial number doesnt crash on silly input
Entered testcase - DNA bases are the correct residue type after mutation
  mutated base to type "DC"
  mutated base to type "DG"
  mutated base to type "DA"
  mutated base to type "DT"
  mutated base to type "Cd"
  mutated base to type "Gd"
  mutated base to type "Ad"
  mutated base to type "Td"
PASS: DNA bases are the correct residue type after mutation
Entered testcase - SegIDs are correct after mutate
PASS: SegIDs are correct after mutate
Entered testcase - TER on water chain is removed on adding a water by hand
PASS: TER on water chain is removed on adding a water by hand
Entered testcase - TER on water chain is removed on adding waters automatically
PASS: TER on water chain is removed on adding waters automatically
Entered testcase - Adding atoms to Many-Chained Molecule
PASS: Adding atoms to Many-Chained Molecule
Entered testcase - Arrange waters round protein
PASS: Arrange waters round protein
Entered testcase - Correct Segid After Add Terminal Residue
PASS: Correct Segid After Add Terminal Residue
Entered testcase - Correct Segid after NCS residue range copy
PASS: Correct Segid after NCS residue range copy
Entered testcase - Merge Water Chains
PASS: Merge Water Chains
Entered testcase - Consolidated merge
-------- starting chain list ----------- 
DEBUG:: (chain-ids imol) is ("A" "B" "C" "D" "")
DEBUG:: chain-list is ("A" "B" "C" "D" "" "E" "F" "G" "H" "I" "J" "K")
PASS: Consolidated merge
Entered testcase - Test for good chain ids after a merge
chain-ids: ("AAA" "B" "B-chain")
--- chain-ids: ("AAA" "B" "B-chain" "AAA_2")
PASS: Test for good chain ids after a merge
Entered testcase - LSQ by atom
bond-length-within-tolerance? bond-length 0.110921496735531 with target 0.0 and tolerance 0.2 for atom ((" C  " "") (1.0 15.5799999237061 " C" "") (56.8940010070801 1.29299998283386 19.6700000762939)) is ((" C  " "") (1.0 16.7800006866455 " C" "") (56.8856086730957 1.18242847919464 19.6726627349854))
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 91 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/pdb1py3.ent
 PDB file /lmb/home/pemsley/data/greg-data/pdb1py3.ent has been read.
Spacegroup: C 1 2 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 1 biomt matrices
INFO:: NCS chain comparison 91/204
INFO:: NCS chain comparison 90/204
INFO:: NCS chain comparison 175/179
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain C onto Chain B"
Molecule 92 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: spacegroup: P 21 21 21
INFO:: spacegroup: C 1 2 1
INFO:: Matching/moving molecule number 91 to 92
INFO:: LSQ matched 164 atoms
INFO:: 164 matched atoms had: 
   mean devi: 0.5023
    rms devi: 0.5938
    max devi: 1.679
    min devi: 0.04318
INFO:: Axis orientation: (     0.567,   -0.7175,    0.4046)
INFO:: Rotation in CCP4 Polar Angles: Polar = (113.863,128.32,41.8019)
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:48:32_2018_modification_0.pdb.gz
INFO:: coordinates transformed by orthogonal matrix: 
|    0.8273,    0.1661,    0.5366|
|   -0.3732,    0.8765,    0.3041|
|   -0.4199,   -0.4519,    0.7871|
(     33.77,    -3.902,    -16.53)
INFO:: fractional coordinates matrix:
|    0.8273,    0.2005,    0.3208|
|   -0.3092,    0.8765,    0.1506|
|   -0.7024,   -0.9123,    0.7871|
(    0.5204,  -0.04982,    -0.426)
INFO:: spacegroup: C 1 2 1
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 93 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:48:36_2018_modification_0.pdb.gz
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 94 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/2goz-manip.pdb
 PDB file /lmb/home/pemsley/data/greg-data/2goz-manip.pdb has been read.
Spacegroup: C 1 2 1
INFO:: Found 1 models
   Model 1 had 7 links
in add_molecular_symmetry_matrices() made 1 biomt matrices
INFO:: NCS chain comparison 10/85
Molecule 95 read successfully
DEBUG:: there were 7 types with no dictionary 
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 96 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 1.5
INFO grid sampling...Nuvw = ( 108, 132,  64)
INFO:: 0.033 seconds to read MTZ file
INFO:: 0 seconds to initialize map
INFO:: 0.022 seconds for FFT
INFO:: 0.004 seconds for statistics
      Map mean: ........ 1.041e-09
      Map sigma: ....... 0.3115
      Map maximum: ..... 2.978
      Map minimum: ..... -0.875
INFO:: 0.118 seconds for contour map
INFO:: 0.177 seconds in total
masking....masking done
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:48:49_2018_modification_0.pdb.gz
INFO:: replace_coords: 745 atoms updated.
SFAC LINE: SFAC C H N O S
INFO:: CELL set to 5.903 13.7 9.237 90 98.21 90
READ-INS:: Spacegroup: "P 1 21/c 1"
INFO:: read_file() chain with chain id  has 2 residues
Symmetry available for this molecule
Molecule 98 read successfully
LATT LINE: LATT -2
SFAC LINE: SFAC C H N O CO
INFO:: CELL set to 34.32 34.32 11.09 90 90 90
READ-INS:: Spacegroup: "I 41 2 2"
INFO:: read_file() chain with chain id  has 2 residues
Symmetry available for this molecule
Molecule 99 read successfully
INFO:: spacegroup: I 41 2 2
LATT LINE: LATT -2
SFAC LINE: SFAC  C  H  N  O  S
INFO:: CELL set to 77.73 77.73 77.73 90 90 90
READ-INS:: Spacegroup: "I 21 3"
INFO:: read_file() chain with chain id  has 121 residues
Symmetry available for this molecule
Molecule 100 read successfully
Map statistics: mean: -5.07e-05 st.d: 0.3052
Map statistics: min: -0.781, max: 6.079
   -0.6953    231
   -0.5238    4724
   -0.3523    24910
   -0.1808    55291
  -0.00927    95241
    0.1622    40930
    0.3337    7480
    0.5052    3968
    0.6767    2790
    0.8482    2117
      1.02    1738
     1.191    1221
     1.363    888
     1.534    595
     1.706    355
     1.877    240
     2.049    137
      2.22    97
     2.392    62
     2.563    46
     2.735    17
     2.906    17
     3.078    13
     3.249    10
     3.421    7
     3.592    1
     3.764    3
     3.935    7
     4.107    2
     4.278    5
      4.45    1
     4.621    2
     4.793    2
     4.964    0
     5.136    1
     5.307    0
     5.479    0
      5.65    0
     5.822    0
     5.993    0
     6.165    1
Map statistics: mean: -1.005e-05 st.d: 0.04681
Map statistics: min: -0.2115, max: 0.6486
   -0.2008    7
   -0.1793    48
   -0.1578    209
   -0.1363    787
   -0.1148    2257
  -0.09325    5676
  -0.07175    12730
  -0.05025    24380
  -0.02874    38191
 -0.007239    46229
   0.01427    43880
   0.03577    32484
   0.05727    19420
   0.07878    9718
    0.1003    4120
    0.1218    1677
    0.1433    718
    0.1648    329
    0.1863    133
    0.2078    77
    0.2293    29
    0.2508    11
    0.2723    13
    0.2938    8
    0.3153    2
    0.3368    2
    0.3583    2
    0.3798    1
    0.4013    1
    0.4228    2
    0.4443    2
    0.4658    1
    0.4873    1
    0.5088    1
    0.5304    1
    0.5519    1
    0.5734    0
    0.5949    0
    0.6164    0
    0.6379    2
    0.6594    0
INFO:: spacegroup: I 21 3
INFO:: spacegroup: I 21 3
INFO:: spacegroup: I 21 3
WARNING:: invalid molecule (204050) for write_shelx_ins_file
WARNING:: failed to get AFIX handle for "A" 1 "ASP" " N  "
WARNING:: failed to get AFIX handle for "A" 1 "ASP" " CA "
WARNING:: failed to get AFIX handle for "A" 1 "ASP" " CB "
WARNING:: failed to get AFIX handle for "A" 1 "ASP" " CG "
WARNING:: failed to get AFIX handle for "A" 1 "ASP" " OD1"
WARNING:: failed to get AFIX handle for "A" 1 "ASP" " OD2"
WARNING:: failed to get AFIX handle for "A" 1 "ASP" " C  "
WARNING:: failed to get AFIX handle for "A" 1 "ASP" " O  "
WARNING:: failed to get AFIX handle for "A" 2 "VAL" " N  "
WARNING:: failed to get AFIX handle for "A" 2 "VAL" " CA "
INFO:: SHELXL file rnase.ins written.
fitting terminal residue with 1000 random trials
                     called fit_terminal_residue_generic() residue-seqnum: 2020 offset: 1
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
DEBUG:: oops residue subject_res_num 2019 - No atoms
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
INFO:: mutating residue in add_cb_to_terminal_res
INFO:: backup file coot-backup/atom_selection_from_insulin.res_Sat_Jan__6_07:48:51_2018_modification_0.res
WARNING:: failed to get AFIX handle for "B" 2010 "HIS" " N  "
WARNING:: failed to get AFIX handle for "B" 2010 "HIS" " CA "
WARNING:: failed to get AFIX handle for "B" 2010 "HIS" " C  "
WARNING:: failed to get AFIX handle for "B" 2010 "HIS" " O  "
WARNING:: failed to get AFIX handle for "B" 2010 "HIS" " CB "
WARNING:: failed to get AFIX handle for "B" 2010 "HIS" " CG "
WARNING:: failed to get AFIX handle for "B" 2010 "HIS" " ND1"
WARNING:: failed to get AFIX handle for "B" 2010 "HIS" " CE1"
WARNING:: failed to get AFIX handle for "B" 2010 "HIS" " NE2"
WARNING:: failed to get AFIX handle for "B" 2010 "HIS" " CD2"
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_insulin.res_Sat_Jan__6_07:48:51_2018_modification_0.res
WARNING:: failed to get AFIX handle for "A" 1001 "GLY" " N  "
WARNING:: failed to get AFIX handle for "A" 1001 "GLY" " CA "
WARNING:: failed to get AFIX handle for "A" 1001 "GLY" " C  "
WARNING:: failed to get AFIX handle for "A" 1001 "GLY" " O  "
WARNING:: failed to get AFIX handle for "A" 1002 "ILE" " N  "
WARNING:: failed to get AFIX handle for "A" 1002 "ILE" " CA "
WARNING:: failed to get AFIX handle for "A" 1002 "ILE" " CB "
WARNING:: failed to get AFIX handle for "A" 1002 "ILE" " CG2"
WARNING:: failed to get AFIX handle for "A" 1002 "ILE" " CG1"
WARNING:: failed to get AFIX handle for "A" 1002 "ILE" " CD1"
1/D/3069 {HOH}/ O   altLoc :: segid :: pos: (3,-1,60) B-factor: 45 added to molecule
INFO:: Protein centre at: xyz = (   -0.2998,      10.6,     57.56)
using sigma cut off 0.6
Calling lig.water_fit()
INFO:: find_clusters map_rms is 0.3052
INFO:: Using density cut-off: 0.1831 (0.6 sigma)  (mean -0.02035 stdev: 0.1119)
INFO:: Blobs with volume larger than 11 A^3 are too big to be considered waters.
INFO:: Using water to protein distance limits: 2.4 3.2
INFO:: Finding clusters...done
-------------------------------------------------------------
INFO:: cluster at xyz = (    -4.859,      20.8,      69.7) is too big to be water
INFO:: cluster at xyz = (     4.249,    -1.354,     48.69) is too big to be water
INFO:: cluster at xyz = (   0.05491,      16.3,     69.67) is too big to be water
INFO:: cluster at xyz = (     15.59,      8.13,     53.24) is too big to be water
INFO:: cluster at xyz = (     20.55,     4.875,     65.84) is too big to be water
INFO:: cluster at xyz = (    -5.054,     9.822,     69.12) is too big to be water
INFO:: found 28 waters in water fitting
Done - back from lig.water_fit()
DEBUG::  new_waters_mol_flag: 0
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_insulin.res_Sat_Jan__6_07:48:51_2018_modification_1.res
WARNING:: failed to get AFIX handle for "A" 1001 "GLY" " N  "
WARNING:: failed to get AFIX handle for "A" 1001 "GLY" " CA "
WARNING:: failed to get AFIX handle for "A" 1001 "GLY" " C  "
WARNING:: failed to get AFIX handle for "A" 1001 "GLY" " O  "
WARNING:: failed to get AFIX handle for "A" 1002 "ILE" " N  "
WARNING:: failed to get AFIX handle for "A" 1002 "ILE" " CA "
WARNING:: failed to get AFIX handle for "A" 1002 "ILE" " CB "
WARNING:: failed to get AFIX handle for "A" 1002 "ILE" " CG2"
WARNING:: failed to get AFIX handle for "A" 1002 "ILE" " CG1"
WARNING:: failed to get AFIX handle for "A" 1002 "ILE" " CD1"
INFO:: Adding to solvent chain: D
LATT LINE: LATT -1
SFAC LINE: SFAC  C  H  N  O  S  SE  CL
WARNING:: BAD ATOM line 17 2 field(s) :DAMP 0.3:
INFO:: CELL set to 42.14 83.03 89.79 90 90 90
READ-INS:: Spacegroup: "P 21 21 21"
INFO:: read_file() chain with chain id  has 5 residues
Symmetry available for this molecule
Molecule 105 read successfully
LATT LINE: LATT -1
SFAC LINE: SFAC C H N O MG CL
INFO:: CELL set to 14.08 32.76 18.66 90 101.7 90
READ-INS:: Spacegroup: "P 1 21 1"
INFO:: read_file() chain with chain id  has 23 residues
Symmetry available for this molecule
Molecule 106 read successfully
WARNING:: failed to get AFIX handle for "A" 1 "CPC" " C1 "
WARNING:: failed to get AFIX handle for "A" 1 "CPC" " O1 "
WARNING:: failed to get AFIX handle for "A" 1 "CPC" " C2 "
WARNING:: failed to get AFIX handle for "A" 1 "CPC" " C3 "
WARNING:: failed to get AFIX handle for "A" 1 "CPC" " H3 "
WARNING:: failed to get AFIX handle for "A" 1 "CPC" " C4 "
WARNING:: failed to get AFIX handle for "A" 1 "CPC" " H4 "
WARNING:: failed to get AFIX handle for "A" 1 "CPC" " C5 "
WARNING:: failed to get AFIX handle for "A" 1 "CPC" "CL1 "
WARNING:: failed to get AFIX handle for "A" 1 "CPC" " N1 "
INFO:: SHELXL file new-horma.ins written.
LATT LINE: LATT -1
SFAC LINE: SFAC  C  H  N  O  MG  CL
debug:: ## new chain wiith chain-id A
INFO:: CELL set to 14.08 32.76 18.66 90 101.7 90
READ-INS:: Spacegroup: "P 1 21 1"
INFO:: read_file() chain with chain id A has 23 residues
Symmetry available for this molecule
Molecule 107 read successfully
LATT LINE: LATT -2
SFAC LINE: SFAC S
INFO:: CELL set to 109 109 107.6 90 90 90
READ-INS:: Spacegroup: "I 4 2 2"
INFO:: read_file() chain with chain id  has 4 residues
Symmetry available for this molecule
Molecule 108 read successfully
INFO:: Creating directory coot-ccp4
INFO:: Reading coordinate file: coot-ccp4/monomer-3GP.pdb
 PDB file coot-ccp4/monomer-3GP.pdb has been read.
Spacegroup: P 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 109 read successfully
DEBUG:: there were 1 types with no dictionary 
INFO:: backup file coot-backup/coot-ccp4_monomer-3GP.pdb_Sat_Jan__6_07:49:00_2018_modification_0.pdb.gz
Welcome to Coot
INFO:: backup file coot-backup/coot-ccp4_monomer-3GP.pdb_Sat_Jan__6_07:49:00_2018_modification_1.pdb.gz
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/monomer-3GP.pdb
 PDB file /lmb/home/pemsley/data/greg-data/monomer-3GP.pdb has been read.
Spacegroup: P 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 110 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_monomer-3GP.pdb_Sat_Jan__6_07:49:05_2018_modification_0.pdb.gz
INFO:: comp-id: LIG is marked for non-autoloading - stopping now 
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/test-LIG.pdb
 PDB file /lmb/home/pemsley/data/greg-data/test-LIG.pdb has been read.
No Spacegroup found for this PDB file
INFO:: Found 1 models
   Model 1 had 0 links
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 111 read successfully
DEBUG:: there were 1 types with no dictionary 
INFO:: comp-id: LIG is marked for non-autoloading - stopping now 
INFO:: comp-id: LIG is marked for non-autoloading - stopping now 
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/test-LIG.pdb
 PDB file /lmb/home/pemsley/data/greg-data/test-LIG.pdb has been read.
No Spacegroup found for this PDB file
INFO:: Found 1 models
   Model 1 had 0 links
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 112 read successfully
DEBUG:: there were 1 types with no dictionary 
INFO:: comp-id: LIG is marked for non-autoloading - stopping now 
INFO:: backup file coot-backup/coot-ccp4_monomer-3GP.pdb_Sat_Jan__6_07:49:00_2018_modification_2.pdb.gz
------------ ERROR! -------------------
       moving_atoms_asc_type not known: 0
------------ ERROR! -------------------
attempting to delete NULL moving_atoms_asc.mol
ignoring 
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/monomer-NPO.pdb
 PDB file /lmb/home/pemsley/data/greg-data/monomer-NPO.pdb has been read.
Spacegroup: P 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 113 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/pdb43ca-sans-NPO-refmaced.pdb
 PDB file /lmb/home/pemsley/data/greg-data/pdb43ca-sans-NPO-refmaced.pdb has been read.
Spacegroup: C 2 2 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 10/113
INFO:: NCS chain comparison 107/113
INFO:: NCS chain comparison 10/113
INFO:: NCS chain comparison 107/113
INFO:: NCS chain comparison 10/113
INFO:: NCS chain comparison 107/113
INFO:: NCS chain comparison 10/113
INFO:: NCS chain comparison 0/113
INFO:: NCS chain comparison 10/117
INFO:: NCS chain comparison 112/117
INFO:: NCS chain comparison 10/117
INFO:: NCS chain comparison 112/117
INFO:: NCS chain comparison 10/117
INFO:: NCS chain comparison 112/117
INFO:: NCS chain comparison 0/117
  INFO:: fill_ghost_info Constructed 6 ghosts
      Ghost 0 name: "NCS found from matching Chain C onto Chain A"
      Ghost 1 name: "NCS found from matching Chain E onto Chain A"
      Ghost 2 name: "NCS found from matching Chain G onto Chain A"
      Ghost 3 name: "NCS found from matching Chain D onto Chain B"
      Ghost 4 name: "NCS found from matching Chain F onto Chain B"
      Ghost 5 name: "NCS found from matching Chain H onto Chain B"
Molecule 119 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: making conventional map from MTZ filename /lmb/home/pemsley/data/greg-data/pdb43ca-sans-NPO-refmaced.mtz using FWT PHWT
Number of OBSERVED reflections: 54440
INFO:: finding ASU unique map points with sampling rate 1.5
INFO grid sampling...Nuvw = ( 160, 160, 336)
INFO:: 0.177 seconds to read MTZ file
INFO:: 0.124 seconds to initialize map
INFO:: 0.107 seconds for FFT
INFO:: 0.018 seconds for statistics
      Map mean: ........ -8.79e-07
      Map sigma: ....... 0.1712
      Map maximum: ..... 1.343
      Map minimum: ..... -0.6954
INFO:: 0.048 seconds for contour map
INFO:: 0.474 seconds in total
INFO:: making difference map from MTZ filename /lmb/home/pemsley/data/greg-data/pdb43ca-sans-NPO-refmaced.mtz using DELFWT PHDELWT
Number of OBSERVED reflections: 54440
INFO:: finding ASU unique map points with sampling rate 1.5
INFO grid sampling...Nuvw = ( 160, 160, 336)
INFO:: 0.094 seconds to read MTZ file
INFO:: 0.002 seconds to initialize map
INFO:: 0.098 seconds for FFT
INFO:: 0.017 seconds for statistics
      Map mean: ........ 2.094e-06
      Map sigma: ....... 0.03339
      Map maximum: ..... 0.3661
      Map minimum: ..... -0.1917
INFO:: 0.018 seconds for contour map
INFO:: 0.229 seconds in total
INFO:: ligand number 0 is molecule number 113   with wiggly flag: 0
in execute_ligand_search_internal() import maps from mol 120
INFO:: Protein centre at: xyz = (     58.29,     34.65,     30.63)
Map statistics: mean: -0.02167 st.d: 0.08863
Map statistics: min: -0.6954, max: 0.7542
   -0.6773    6
   -0.6411    8
   -0.6048    27
   -0.5686    116
   -0.5324    354
   -0.4961    977
   -0.4599    1943
   -0.4236    3356
   -0.3874    5156
   -0.3511    6576
   -0.3149    7850
   -0.2787    8875
   -0.2424    9742
   -0.2062    11742
   -0.1699    16950
   -0.1337    29805
  -0.09746    58214
  -0.06122    102889
  -0.02498    142998
   0.01126    471776
    0.0475    106846
   0.08375    56087
      0.12    21597
    0.1562    6911
    0.1925    2135
    0.2287    920
     0.265    467
    0.3012    346
    0.3374    216
    0.3737    118
    0.4099    117
    0.4462    80
    0.4824    50
    0.5186    28
    0.5549    33
    0.5911    15
    0.6274    14
    0.6636    11
    0.6998    2
    0.7361    7
    0.7723    0
INFO:: find_clusters map_rms is 0.1711
INFO:: Using density cut-off: 0.1711 (1 sigma)  (mean -0.02168 stdev: 0.08862)
INFO:: Blobs with volume larger than 11 A^3 are too big to be considered waters.
INFO:: Using water to protein distance limits: 2.4 3.2
INFO:: Finding clusters...done
debug:: n_ligands_for_cluster() top_score 4.042 and 4 are decent out of 12
------------ ERROR! -------------------
       moving_atoms_asc_type not known: 0
------------ ERROR! -------------------
attempting to delete NULL moving_atoms_asc.mol
ignoring 
debug:: n_ligands_for_cluster() top_score 2.018 and 8 are decent out of 12
------------ ERROR! -------------------
       moving_atoms_asc_type not known: 0
------------ ERROR! -------------------
attempting to delete NULL moving_atoms_asc.mol
ignoring 
debug:: n_ligands_for_cluster() top_score 2.09 and 4 are decent out of 12
------------ ERROR! -------------------
       moving_atoms_asc_type not known: 0
------------ ERROR! -------------------
attempting to delete NULL moving_atoms_asc.mol
ignoring 
debug:: n_ligands_for_cluster() top_score 1.859 and 6 are decent out of 12
------------ ERROR! -------------------
       moving_atoms_asc_type not known: 0
------------ ERROR! -------------------
attempting to delete NULL moving_atoms_asc.mol
ignoring 
debug:: n_ligands_for_cluster() top_score 1.391 and 10 are decent out of 12
------------ ERROR! -------------------
       moving_atoms_asc_type not known: 0
------------ ERROR! -------------------
attempting to delete NULL moving_atoms_asc.mol
ignoring 
debug:: n_ligands_for_cluster() top_score 1.684 and 8 are decent out of 12
------------ ERROR! -------------------
       moving_atoms_asc_type not known: 0
------------ ERROR! -------------------
attempting to delete NULL moving_atoms_asc.mol
ignoring 
debug:: n_ligands_for_cluster() top_score 2.096 and 8 are decent out of 12
------------ ERROR! -------------------
       moving_atoms_asc_type not known: 0
------------ ERROR! -------------------
attempting to delete NULL moving_atoms_asc.mol
ignoring 
debug:: n_ligands_for_cluster() top_score 1.636 and 8 are decent out of 12
------------ ERROR! -------------------
       moving_atoms_asc_type not known: 0
------------ ERROR! -------------------
attempting to delete NULL moving_atoms_asc.mol
ignoring 
debug:: n_ligands_for_cluster() top_score 2.07 and 3 are decent out of 12
------------ ERROR! -------------------
       moving_atoms_asc_type not known: 0
------------ ERROR! -------------------
attempting to delete NULL moving_atoms_asc.mol
ignoring 
debug:: n_ligands_for_cluster() top_score 1.857 and 5 are decent out of 12
------------ ERROR! -------------------
       moving_atoms_asc_type not known: 0
------------ ERROR! -------------------
attempting to delete NULL moving_atoms_asc.mol
ignoring 
INFO:: Reading coordinate file: coot-ccp4/monomer-3GP.pdb
 PDB file coot-ccp4/monomer-3GP.pdb has been read.
Spacegroup: P 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 133 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/Copy_of_coot-ccp4_monomer-3GP.pdb_Sat_Jan__6_07:49:40_2018_modification_0.pdb.gz
INFO:: replace_coords: 36 atoms updated.
INFO:: backup file coot-backup/Copy_of_coot-ccp4_monomer-3GP.pdb_Sat_Jan__6_07:49:40_2018_modification_1.pdb.gz
INFO:: replace_coords: 36 atoms updated.
INFO:: backup file coot-backup/Copy_of_coot-ccp4_monomer-3GP.pdb_Sat_Jan__6_07:49:40_2018_modification_2.pdb.gz
INFO:: replace_coords: 36 atoms updated.
INFO:: backup file coot-backup/Copy_of_coot-ccp4_monomer-3GP.pdb_Sat_Jan__6_07:49:40_2018_modification_3.pdb.gz
INFO:: replace_coords: 36 atoms updated.
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/dipole-residues.pdb
 PDB file /lmb/home/pemsley/data/greg-data/dipole-residues.pdb has been read.
No Spacegroup found for this PDB file
INFO:: Found 1 models
   Model 1 had 0 links
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 135 read successfully
DEBUG:: there were 0 types with no dictionary 
WARNING: in init_refmac_mon_lib, file "/lmb/home/pemsley/data/greg-data/libcheck_3GP.cif" not found.
init_refmac_mon_lib /lmb/home/pemsley/data/greg-data/libcheck_3GP.cif had no bond restraints
WARNING: in init_refmac_mon_lib, file "/lmb/home/pemsley/data/greg-data/libcheck_3GP.cif" not found.
init_refmac_mon_lib /lmb/home/pemsley/data/greg-data/libcheck_3GP.cif had no bond restraints
WARNING: in init_refmac_mon_lib, file "/lmb/home/pemsley/data/greg-data/libcheck_3GP.cif" not found.
init_refmac_mon_lib /lmb/home/pemsley/data/greg-data/libcheck_3GP.cif had no bond restraints
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 136 read successfully
DEBUG:: there were 0 types with no dictionary 
storing sequence: ACDEFGHIKLMNPQ for chain id: A in molecule number 136
storing sequence: ACDEFGHIKLMNPQRST for chain id: A in molecule number 136
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/crashes_on_cootaneering-v2.pdb
 PDB file /lmb/home/pemsley/data/greg-data/crashes_on_cootaneering-v2.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 1/2
INFO:: NCS chain comparison 0/2
INFO:: NCS chain comparison 0/13
Molecule 137 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 1.5
INFO grid sampling...Nuvw = ( 108, 132,  64)
INFO:: 0.029 seconds to read MTZ file
INFO:: 0.001 seconds to initialize map
INFO:: 0.021 seconds for FFT
INFO:: 0.003 seconds for statistics
      Map mean: ........ 1.041e-09
      Map sigma: ....... 0.3115
      Map maximum: ..... 2.978
      Map minimum: ..... -0.875
INFO:: 0.086 seconds for contour map
INFO:: 0.14 seconds in total
storing sequence: DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLID for chain id: A in molecule number 137

Sequence: ?EYTVITPGARTR
Confidence: 1

From    : HEYTVITPGARTR
Chain id: 0	Offset: 53
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_crashes_on_cootaneering-v2.pdb_Sat_Jan__6_07:49:55_2018_modification_0.pdb.gz
bypassing ? at 0
Mutating to GLU at 1
Mutating poly_ala residue number 58
Mutating to TYR at 2
Mutating poly_ala residue number 59
Mutating to THR at 3
Mutating poly_ala residue number 60
Mutating to VAL at 4
Mutating poly_ala residue number 61
Mutating to ILE at 5
Mutating poly_ala residue number 62
Mutating to THR at 6
Mutating poly_ala residue number 63
Mutating to PRO at 7
Mutating poly_ala residue number 64
Mutating to GLY at 8
Mutating poly_ala residue number 65
Mutating to ALA at 9
Mutating poly_ala residue number 66
Mutating to ARG at 10
Mutating poly_ala residue number 67
Mutating to THR at 11
Mutating poly_ala residue number 68
Mutating to ARG at 12
Mutating poly_ala residue number 69
DEBUG:: Creating a new chain B
WARNING:: no rotamers probabilities for residue type GLY
INFO:: replace_coords: 9 atoms updated.
oops! in rotamer::GetResidue() No tree in restraint
oops! in rotamer::GetResidue() No tree in restraint
oops! in rotamer::GetResidue() No tree in restraint
oops! in rotamer::GetResidue() No tree in restraint
oops! in rotamer::GetResidue() No tree in restraint
oops! in rotamer::GetResidue() No tree in restraint
oops! in rotamer::GetResidue() No tree in restraint
oops! in rotamer::GetResidue() No tree in restraint
INFO:: replace_coords: 12 atoms updated.
INFO:: replace_coords: 7 atoms updated.
INFO:: replace_coords: 7 atoms updated.
INFO:: replace_coords: 8 atoms updated.
INFO:: replace_coords: 7 atoms updated.
INFO:: replace_coords: 7 atoms updated.
WARNING:: no rotamers probabilities for residue type GLY
WARNING:: no rotamers probabilities for residue type ALA
INFO:: replace_coords: 11 atoms updated.
INFO:: replace_coords: 7 atoms updated.
INFO:: replace_coords: 11 atoms updated.
INFO:: 5 matched atoms had: 
   mean devi: 0
    rms devi: 0
    max devi: 0
    min devi: 0
INFO:: 5 matched atoms had: 
   mean devi: 0.01207
    rms devi: 0.01345
    max devi: 0.02142
    min devi: 0.003856
INFO:: 5 matched atoms had: 
   mean devi: 0.2702
    rms devi: 0.335
    max devi: 0.536
    min devi: 0.08463
INFO:: 5 matched atoms had: 
   mean devi: 0.2674
    rms devi: 0.3228
    max devi: 0.4951
    min devi: 0.1123
INFO:: 5 matched atoms had: 
   mean devi: 0.2702
    rms devi: 0.335
    max devi: 0.536
    min devi: 0.0847
INFO:: 5 matched atoms had: 
   mean devi: 0.2674
    rms devi: 0.3228
    max devi: 0.4952
    min devi: 0.1122
INFO:: 5 matched atoms had: 
   mean devi: 0.01198
    rms devi: 0.01335
    max devi: 0.02126
    min devi: 0.003873
INFO:: 5 matched atoms had: 
   mean devi: 0.0002426
    rms devi: 0.0002428
    max devi: 0.0002567
    min devi: 0.0002313
INFO:: 5 matched atoms had: 
   mean devi: 0.2702
    rms devi: 0.335
    max devi: 0.536
    min devi: 0.08456
INFO:: 5 matched atoms had: 
   mean devi: 0.2673
    rms devi: 0.3228
    max devi: 0.4951
    min devi: 0.1124
INFO:: 5 matched atoms had: 
   mean devi: 6.931e-05
    rms devi: 6.936e-05
    max devi: 7.334e-05
    min devi: 6.608e-05
INFO:: 5 matched atoms had: 
   mean devi: 0.01203
    rms devi: 0.01341
    max devi: 0.02135
    min devi: 0.003862
INFO:: 5 matched atoms had: 
   mean devi: 0.0001386
    rms devi: 0.0001387
    max devi: 0.0001467
    min devi: 0.0001322
INFO:: 5 matched atoms had: 
   mean devi: 0.012
    rms devi: 0.01337
    max devi: 0.02129
    min devi: 0.003869
INFO:: 5 matched atoms had: 
   mean devi: 0.2674
    rms devi: 0.3228
    max devi: 0.4952
    min devi: 0.1122
INFO:: 5 matched atoms had: 
   mean devi: 0.2703
    rms devi: 0.3351
    max devi: 0.5361
    min devi: 0.08481
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
INFO:: NCS chain comparison 0/8
INFO:: backup file coot-backup/Ideal-A-form-RNA_Sat_Jan__6_07:49:56_2018_modification_0.pdb.gz
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
INFO:: NCS chain comparison 0/8
WARNING:: No symmetry available for this molecule
WARNING:: No Symmetry for this model
INFO:: NCS chain comparison 0/8
INFO:: NCS chain comparison 8/8
First atom of 170 in first  selection 1/A/1 {G}/ P   altLoc :: segid :: pos: (67.8,-2.641,8.312) B-factor: 76.88
First atom of 170 in second selection 1/C/1 {G}/ P   altLoc :: segid :: pos: (91.77,21.39,32.47) B-factor: 76.88
INFO:: LSQ matched 8 atoms
INFO:: 8 matched atoms had: 
   mean devi: 0.1366
    rms devi: 0.1488
    max devi: 0.2364
    min devi: 0.06837
   find_ncs_matrix returns (LSQ) 
|         1, -0.001328, -0.001388|
|  0.001328,         1, 7.875e-05|
|  0.001388, -8.06e-05,         1|
(     -23.9,    -24.18,     -24.2)
INFO:: NCS chain comparison 0/8
INFO:: NCS chain comparison 0/8
INFO:: NCS chain comparison 8/8
First atom of 170 in first  selection 1/B/1 {C}/ P   altLoc :: segid :: pos: (69.19,-2.009,20.54) B-factor: 76.88
First atom of 170 in second selection 1/D/1 {C}/ P   altLoc :: segid :: pos: (93.32,22.21,44.71) B-factor: 76.88
INFO:: LSQ matched 8 atoms
INFO:: 8 matched atoms had: 
   mean devi: 0.09238
    rms devi: 0.09866
    max devi: 0.1642
    min devi: 0.05783
   find_ncs_matrix returns (LSQ) 
|         1,   0.00312,-0.0003107|
| -0.003121,         1, -0.005678|
|  0.000293,  0.005679,         1|
(     -24.2,    -23.62,    -24.33)
  INFO:: fill_ghost_info Constructed 2 ghosts
      Ghost 0 name: "NCS found from matching Chain C onto Chain A"
      Ghost 1 name: "NCS found from matching Chain D onto Chain B"
INFO:: Matching/moving molecule number 141 to 141
ERROR:: No symmetry available
INFO:: LSQ matched 125 atoms
INFO:: 125 matched atoms had: 
   mean devi: 0.1419
    rms devi: 0.1486
    max devi: 0.2431
    min devi: 0.02832
INFO:: Axis orientation: (    0.3864,   -0.6781,   -0.6252)
INFO:: Rotation in CCP4 Polar Angles: Polar = (128.694,-60.3228,0.295209)
INFO:: backup file coot-backup/Copy_of_Ideal-A-form-RNA_Sat_Jan__6_07:50:00_2018_modification_0.pdb.gz
INFO:: coordinates transformed by orthogonal matrix: 
|         1,  0.003218, -0.003497|
| -0.003225,         1, -0.001985|
|  0.003491,  0.001997,         1|
(    -24.05,     -23.7,    -24.44)
No unit cell for this molecule, hence no fractional matrix.
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/1wly.pdb
 PDB file /lmb/home/pemsley/data/greg-data/1wly.pdb has been read.
Spacegroup: C 1 2 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 1 biomt matrices
Molecule 142 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/1yb5.pdb
 PDB file /lmb/home/pemsley/data/greg-data/1yb5.pdb has been read.
Spacegroup: P 21 21 2
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 1 biomt matrices
INFO:: NCS chain comparison 324/324
INFO:: NCS chain comparison 0/324
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 143 read successfully
DEBUG:: there were 2 types with no dictionary 
INFO:: reference 142 has 750 atoms selected
INFO:: moving    143 has 842 atoms selected
superposing...
number of Ca atoms in selections: 110 (moving) and 100 (reference)
Another Go...

     Moving      Reference   Distance(/A)
      A   6
      A   7
      A   8  <--->  A   2  :  0.7510
      A   9  <--->  A   3  :  0.9422
      A  10  <--->  A   4  :  0.6300
      A  11  <--->  A   5  :  0.7119
      A  12  <--->  A   6  :  0.6310
      A  13  <--->  A   7  :  0.4675
      A  14  <--->  A   8  :  0.4264
      A  15  <--->  A   9  :  0.9792
      A  16  <--->  A  10  :  0.7549
      A  17  <--->  A  11  :  0.4884
      A  18  <--->  A  12  :  0.7451
      A  19  <--->  A  13  :  0.4606
      A  20  <--->  A  14  :  1.2809
      A  21  <--->  A  15  :  1.2412
      A  22  <--->  A  16  :  1.0733
      A  23  <--->  A  17  :  0.9730
      A  24  <--->  A  18  :  0.4705
      A  25  <--->  A  19  :  0.3560
      A  26  <--->  A  20  :  3.1145
      A  27
      A  28  <--->  A  21  :  1.5754
      A  29  <--->  A  22  :  1.6322
      A  30
      A  31  <--->  A  23  :  1.9973
      A  32  <--->  A  25  :  1.8324
      A  33  <--->  A  26  :  0.9310
      A  34  <--->  A  27  :  0.6808
      A  35  <--->  A  28  :  0.2674
      A  36  <--->  A  29  :  0.5995
      A  37  <--->  A  30  :  0.6992
      A  38  <--->  A  31  :  0.8620
      A  39  <--->  A  32  :  0.8421
      A  40  <--->  A  33  :  0.7208
      A  41  <--->  A  34  :  0.8681
      A  42  <--->  A  35  :  0.7781
      A  43  <--->  A  36  :  0.6211
      A  44  <--->  A  37  :  0.4657
      A  45  <--->  A  38  :  0.7475
      A  46  <--->  A  39  :  0.5170
      A  47  <--->  A  40  :  0.5058
      A  48  <--->  A  41  :  0.8897
      A  49  <--->  A  42  :  0.5835
      A  50  <--->  A  43  :  0.4347
      A  51  <--->  A  44  :  0.6192
      A  52  <--->  A  45  :  0.2150
      A  53  <--->  A  46  :  0.7474
      A  54  <--->  A  47  :  1.0213
      A  55  <--->  A  48  :  0.9208
      A  56  <--->  A  49  :  0.9392
      A  57
      A  58
      A  59
      A  60
      A  61
      A  62
      A  63
      A  64
      A  65  <--->  A  60  :  0.4666
      A  66  <--->  A  61  :  0.0523
      A  67  <--->  A  62  :  1.0719
      A  68  <--->  A  63  :  0.7933
      A  69  <--->  A  64  :  0.8916
      A  70  <--->  A  65  :  1.2580
      A  71  <--->  A  66  :  0.6932
      A  72  <--->  A  67  :  1.0345
      A  73  <--->  A  68  :  1.4417
      A  74  <--->  A  69  :  0.9092
      A  75  <--->  A  70  :  1.6166
      A  76  <--->  A  71  :  0.8741
      A  77  <--->  A  72  :  0.2388
      A  78  <--->  A  73  :  0.3118
      A  79  <--->  A  74  :  0.3887
      A  80  <--->  A  75  :  0.7613
      A  81  <--->  A  76  :  0.9044
      A  82  <--->  A  77  :  0.6090
      A  83  <--->  A  78  :  1.7978
      A  84  <--->  A  79  :  1.9256
      A  85  <--->  A  80  :  1.3416
      A  86  <--->  A  81  :  0.5658
      A  87  <--->  A  82  :  0.4480
      A  88  <--->  A  83  :  0.9078
      A  89  <--->  A  84  :  0.3625
      A  90  <--->  A  85  :  0.4040
      A  91  <--->  A  86  :  0.4586
      A  92  <--->  A  87  :  0.4340
      A  93  <--->  A  88  :  0.3664
      A  94  <--->  A  89  :  0.4921
      A  95  <--->  A  90  :  0.6498
      A  96  <--->  A  91  :  1.5805
      A  97  <--->  A  92  :  2.8839
      A  98
      A  99
      A 100

 Moving: KLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAG
 Target: --VMAAVIHKKGGPDNFVWEE-VK-VSPGPGQVRLRNTAIGVNFLDTYHRA--------PPIVVGFEAAA

 Moving: VIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVY
 Target: VVEEVGPGVTDFTVGERVCTCL---GAYSQERLYPAEKLI

INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_1yb5.pdb_Sat_Jan__6_07:50:08_2018_modification_0.pdb.gz
INFO:: coordinates transformed by orthogonal matrix: 
|   -0.9117,   -0.3803,    0.1557|
|   -0.3625,    0.9227,     0.131|
|   -0.1935,   0.06299,   -0.9791|
(     70.65,     7.793,     21.29)
  Rotation - polar (omega,phi,kappa)  87.1413 101.0220 169.7385
  Rotation - euler (alpha,beta,gamma) 40.0716 168.2570 18.0277
  Translation - Angstroms             70.6538 7.7930 21.2852 
INFO: core rmsd achieved: 1.0199 Angstroems
      number of residues in reference structure: 322
      number of residues in moving structure:    324
      number of residues in aligned sections (reference):  100
      number of residues in aligned sections (moving):     110
      number of aligned residues:  95
      number of gaps:              4
      number of misdirections:     0
      number of SSE combinations:  4.0000
      sequence identity:           30.5263%
WARNING:: Error reading /lmb/home/pemsley/data/greg-data/1pyd.pdb
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/2qd9.pdb
 PDB file /lmb/home/pemsley/data/greg-data/2qd9.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 1 biomt matrices
Molecule 144 read successfully
DEBUG:: there were 1 types with no dictionary 
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/2gtn.pdb
 PDB file /lmb/home/pemsley/data/greg-data/2gtn.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 1 biomt matrices
INFO:: NCS chain comparison 0/337
Molecule 145 read successfully
DEBUG:: there were 1 types with no dictionary 
INFO:: reference 144 has 169 atoms selected
INFO:: moving    145 has 169 atoms selected
superposing...
number of Ca atoms in selections: 21 (moving) and 21 (reference)
Another Go...

     Moving      Reference   Distance(/A)
      A 140  <--->  A 140  :  0.1804
      A 141  <--->  A 141  :  0.0760
      A 142  <--->  A 142  :  0.1052
      A 143  <--->  A 143  :  0.1246
      A 144  <--->  A 144  :  0.1370
      A 145  <--->  A 145  :  0.1380
      A 146  <--->  A 146  :  0.1662
      A 147  <--->  A 147  :  0.2744
      A 148  <--->  A 148  :  0.2728
      A 149  <--->  A 149  :  0.1173
      A 150  <--->  A 150  :  0.1684
      A 151  <--->  A 151  :  0.0928
      A 152  <--->  A 152  :  0.1200
      A 153  <--->  A 153  :  0.1281
      A 154  <--->  A 154  :  0.2539
      A 155  <--->  A 155  :  0.6351
      A 156  <--->  A 156  :  0.1300
      A 157  <--->  A 157  :  0.1478
      A 158  <--->  A 158  :  0.2238
      A 159  <--->  A 159  :  0.2271
      A 160  <--->  A 160  :  0.2372

 Moving: YIHSADIIHRDLKPSNLAVNE
 Target: YIHSADIIHRDLKPSNLAVNE

INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_2gtn.pdb_Sat_Jan__6_07:50:20_2018_modification_0.pdb.gz
INFO:: coordinates transformed by orthogonal matrix: 
|    0.9998,  0.009845,  -0.01938|
| -0.009814,         1,  0.001689|
|    0.0194, -0.001498,    0.9998|
(    0.3207,    0.6598,    0.8819)
  Rotation - polar (omega,phi,kappa)  116.8035 -94.6984 1.2491
  Rotation - euler (alpha,beta,gamma) 175.0200 1.1149 -175.5832
  Translation - Angstroms             0.3207 0.6598 0.8819 
INFO: core rmsd achieved: 0.2210 Angstroems
      number of residues in reference structure: 330
      number of residues in moving structure:    337
      number of residues in aligned sections (reference):  21
      number of residues in aligned sections (moving):     21
      number of aligned residues:  21
      number of gaps:              0
      number of misdirections:     0
      number of SSE combinations:  1.0000
      sequence identity:           100.0000%
LATT LINE: LATT -2
SFAC LINE: SFAC  C  H  N  O  S
INFO:: CELL set to 77.7260 77.7260 77.7260 90.0000 90.0000 90.0000
READ-INS:: Spacegroup: "I 21 3"
INFO:: read_file() chain with chain id  has 121 residues
Symmetry available for this molecule
Molecule 146 read successfully
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz
Number of OBSERVED reflections: 17939
INFO:: finding ASU unique map points with sampling rate 1.5000
INFO grid sampling...Nuvw = ( 108, 132,  64)
INFO:: 0.0320 seconds to read MTZ file
INFO:: 0.0010 seconds to initialize map
INFO:: 0.0230 seconds for FFT
INFO:: 0.0040 seconds for statistics
      Map mean: ........ 0.0000
      Map sigma: ....... 0.3115
      Map maximum: ..... 2.9776
      Map minimum: ..... -0.8750
INFO:: 0.1050 seconds for contour map
INFO:: 0.1650 seconds in total
INFO:: NCS chain comparison 93/93
First atom of 720 in first  selection 1/A/1 {ASP}/ N   altLoc :: segid :: pos: (44.8780,12.9550,8.7610) B-factor: 30.1700
First atom of 745 in second selection 1/B/1 {ASP}/ N   altLoc :: segid :: pos: (13.8760,16.1670,23.0330) B-factor: 20.0300
INFO:: LSQ matched 93 atoms
INFO:: 93 matched atoms had: 
   mean devi: 1.1788
    rms devi: 4.8592
    max devi: 46.2590
    min devi: 0.1254
   find_ncs_matrix returns (LSQ) 
|    0.9637,  -0.07462,   -0.2563|
|    0.2651,    0.3804,     0.886|
|    0.0314,   -0.9218,    0.3864|
(     38.09,    -17.87,     14.32)
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
INFO:: installing ghost map with name :Map 3 NCS found from matching Chain B onto Chain A
Done install_ghost_map
Reference matcher: 0 and 0
|    0.9637,  -0.07462,   -0.2563|
|    0.2651,    0.3804,     0.886|
|    0.0314,   -0.9218,    0.3864|
(     38.09,    -17.87,     14.32)
inverse of reference matcher transformation:
|    0.9637,    0.2651,    0.0314|
|  -0.07462,    0.3804,   -0.9218|
|   -0.2563,     0.886,    0.3864|
(    -32.42,     22.84,     20.06)
boxing over uvw = (  -0.04469,   -0.1739,   -0.2816) to uvw = (     1.228,    0.3332,    0.7985)
INFO:: There were 2.0000 maps contributing to the average
INFO:: rescaling by 0.5000
INFO:: 737280 out of 737280 (100.0000%) map points  were masked out of NCS average target volume,  chain A
INFO:: made 1 averaged map(s)
Map statistics: mean: 0.0003 st.d: 0.3250
Map statistics: min: -1.4894, max: 2.4019
   -1.4407    3
   -1.3435    7
   -1.2462    16
   -1.1489    7
   -1.0516    17
   -0.9543    61
   -0.8570    255
   -0.7598    907
   -0.6625    3123
   -0.5652    9819
   -0.4679    26025
   -0.3706    54787
   -0.2733    87759
   -0.1761    106866
   -0.0788    105275
    0.0185    88484
    0.1158    67330
    0.2131    50443
    0.3103    38437
    0.4076    28654
    0.5049    21003
    0.6022    15144
    0.6995    10724
    0.7968    7514
    0.8940    5100
    0.9913    3555
    1.0886    2282
    1.1859    1498
    1.2832    914
    1.3804    569
    1.4777    316
    1.5750    169
    1.6723    84
    1.7696    44
    1.8669    35
    1.9641    30
    2.0614    9
    2.1587    9
    2.2560    2
    2.3533    3
    2.4506    1
INFO:: installing ghost map with name :Map 147 NCS found from matching Chain B onto Chain A
Done install_ghost_map
Reference matcher: 0 and 0
|    0.9637,  -0.07462,   -0.2563|
|    0.2651,    0.3804,     0.886|
|    0.0314,   -0.9218,    0.3864|
(     38.09,    -17.87,     14.32)
inverse of reference matcher transformation:
|    0.9637,    0.2651,    0.0314|
|  -0.07462,    0.3804,   -0.9218|
|   -0.2563,     0.886,    0.3864|
(    -32.42,     22.84,     20.06)
boxing over uvw = (  -0.04469,   -0.1739,   -0.2816) to uvw = (     1.228,    0.3332,    0.7985)
INFO:: There were 2.0000 maps contributing to the average
INFO:: rescaling by 0.5000
INFO:: 228096 out of 228096 (100.0000%) map points  were masked out of NCS average target volume,  chain A
INFO:: made 1 averaged map(s)
Map statistics: mean: 0.0004 st.d: 0.3236
Map statistics: min: -1.4496, max: 2.3411
   -1.4022    3
   -1.3074    1
   -1.2127    4
   -1.1179    8
   -1.0231    5
   -0.9283    32
   -0.8336    104
   -0.7388    349
   -0.6440    1163
   -0.5493    3433
   -0.4545    8783
   -0.3597    17620
   -0.2650    27133
   -0.1702    32345
   -0.0754    31462
    0.0193    26827
    0.1141    20587
    0.2089    15419
    0.3036    11965
    0.3984    8787
    0.4932    6637
    0.5879    4777
    0.6827    3343
    0.7775    2426
    0.8722    1733
    0.9670    1142
    1.0618    796
    1.1565    469
    1.2513    296
    1.3461    188
    1.4409    96
    1.5356    80
    1.6304    34
    1.7252    20
    1.8199    14
    1.9147    6
    2.0095    4
    2.1042    3
    2.1990    0
    2.2938    2
    2.3885    0
no diffs
NCS target chain has 93 peers.
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb
 PDB file /lmb/home/pemsley/data/greg-data/tutorial-modern.pdb has been read.
Spacegroup: P 21 21 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
INFO:: NCS chain comparison 93/93
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
Molecule 152 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:50:30_2018_modification_0.pdb.gz
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:50:30_2018_modification_1.pdb.gz
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:50:30_2018_modification_2.pdb.gz
INFO:: NCS chain comparison 90/93
First atom of 720 in first  selection 1/A/1 {ASP}/ N   altLoc :: segid :: pos: (44.8780,12.9550,8.7610) B-factor: 30.1700
First atom of 724 in second selection 1/B/4 {GLY}/ N   altLoc :: segid :: pos: (18.1830,22.2640,18.9300) B-factor: 21.7100
INFO:: LSQ matched 90 atoms
INFO:: 90 matched atoms had: 
   mean devi: 0.3643
    rms devi: 0.4571
    max devi: 2.1351
    min devi: 0.0881
   find_ncs_matrix returns (LSQ) 
|    0.9705,  -0.04634,   -0.2366|
|    0.2357,    0.3884,    0.8908|
|   0.05061,   -0.9203,    0.3878|
(      37.8,    -17.18,     13.82)
  INFO:: fill_ghost_info Constructed 1 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
DEBUG ncs_control_change_ncs_master_to_chain_update_widget imol: 152 and ichain: 0
DEBUG:: ncs_control_change_ncs_master_to_chain imol: 152 and ichain: 0
   %%%%%% add_ncs_ghosts_using_ncs_master 
   %%%%%% imaster: 0
   Checking chains for NCS matching to chain A
INFO:: NCS chain comparison 90/93
First atom of 720 in first  selection 1/A/1 {ASP}/ N   altLoc :: segid :: pos: (44.8780,12.9550,8.7610) B-factor: 30.1700
First atom of 724 in second selection 1/B/4 {GLY}/ N   altLoc :: segid :: pos: (18.1830,22.2640,18.9300) B-factor: 21.7100
INFO:: LSQ matched 90 atoms
INFO:: 90 matched atoms had: 
   mean devi: 0.3643
    rms devi: 0.4571
    max devi: 2.1351
    min devi: 0.0881
   find_ncs_matrix returns (LSQ) 
|    0.9705,  -0.04634,   -0.2366|
|    0.2357,    0.3884,    0.8908|
|   0.05061,   -0.9203,    0.3878|
(      37.8,    -17.18,     13.82)
   Adding ghost with name: NCS found from matching Chain B onto Chain A
INFO:: set_ncs_master_chain Constructed 1 ghosts
   Ghost info:: NCS found from matching Chain B onto Chain A
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:50:30_2018_modification_3.pdb.gz
INFO:: mutate 2 A to a TRP
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:50:30_2018_modification_4.pdb.gz
DEBUG ncs_control_change_ncs_master_to_chain_update_widget imol: 152 and ichain: 0
DEBUG:: ncs_control_change_ncs_master_to_chain imol: 152 and ichain: 0
   %%%%%% add_ncs_ghosts_using_ncs_master 
   %%%%%% imaster: 0
   Checking chains for NCS matching to chain A
INFO:: NCS chain comparison 92/93
First atom of 727 in first  selection 1/A/1 {ASP}/ N   altLoc :: segid :: pos: (44.8780,12.9550,8.7610) B-factor: 30.1700
First atom of 745 in second selection 1/B/1 {ASP}/ N   altLoc :: segid :: pos: (13.7154,16.0316,23.2057) B-factor: 30.1700
INFO:: LSQ matched 93 atoms
INFO:: 93 matched atoms had: 
   mean devi: 0.3427
    rms devi: 0.4454
    max devi: 2.1352
    min devi: 0.0124
   find_ncs_matrix returns (LSQ) 
|    0.9705,  -0.04643,   -0.2365|
|    0.2356,    0.3891,    0.8906|
|   0.05068,     -0.92,    0.3886|
(      37.8,    -17.17,     13.81)
   Adding ghost with name: NCS found from matching Chain B onto Chain A
INFO:: set_ncs_master_chain Constructed 1 ghosts
   Ghost info:: NCS found from matching Chain B onto Chain A
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_tutorial-modern.pdb_Sat_Jan__6_07:50:30_2018_modification_5.pdb.gz
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/pdb1t6q.ent
 PDB file /lmb/home/pemsley/data/greg-data/pdb1t6q.ent has been read.
Spacegroup: C 2 2 21
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 2 biomt matrices
INFO:: NCS chain comparison 110/110
INFO:: NCS chain comparison 110/110
  INFO:: fill_ghost_info Constructed 2 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
      Ghost 1 name: "NCS found from matching Chain C onto Chain A"
Molecule 153 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: mutate 50 A to a ASP
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_pdb1t6q.ent_Sat_Jan__6_07:50:37_2018_modification_0.pdb.gz
INFO:: NCS chain comparison 109/110
First atom of 881 in first  selection 1/A/7 {GLY}/ N   altLoc :: segid :: pos: (31.7950,49.9730,50.8660) B-factor: 68.1800
First atom of 893 in second selection 1/B/6 {CYS}/ N   altLoc :: segid :: pos: (45.3620,34.2400,30.6710) B-factor: 84.3600
INFO:: LSQ matched 110 atoms
INFO:: 110 matched atoms had: 
   mean devi: 0.2048
    rms devi: 0.2651
    max devi: 1.1707
    min devi: 0.0160
   find_ncs_matrix returns (LSQ) 
|    0.5407,    0.4775,    0.6926|
|   -0.4862,   -0.4944,    0.7205|
|    0.6865,   -0.7263,  -0.03511|
(    -28.15,     65.89,      42.9)
INFO:: NCS chain comparison 109/110
First atom of 881 in first  selection 1/A/7 {GLY}/ N   altLoc :: segid :: pos: (31.7950,49.9730,50.8660) B-factor: 68.1800
First atom of 881 in second selection 1/C/7 {GLY}/ N   altLoc :: segid :: pos: (47.6640,58.9920,25.9960) B-factor: 67.7200
INFO:: LSQ matched 110 atoms
INFO:: 110 matched atoms had: 
   mean devi: 0.2275
    rms devi: 0.3035
    max devi: 1.6549
    min devi: 0.0661
   find_ncs_matrix returns (LSQ) 
|    0.5303,   -0.4851,    0.6953|
|    0.4758,   -0.5085,   -0.7177|
|    0.7017,    0.7114,  -0.03884|
(     18.19,     77.78,    -25.69)
  INFO:: fill_ghost_info Constructed 2 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
      Ghost 1 name: "NCS found from matching Chain C onto Chain A"
DEBUG ncs_control_change_ncs_master_to_chain_update_widget imol: 153 and ichain: 0
DEBUG:: ncs_control_change_ncs_master_to_chain imol: 153 and ichain: 0
   %%%%%% add_ncs_ghosts_using_ncs_master 
   %%%%%% imaster: 0
   Checking chains for NCS matching to chain A
INFO:: NCS chain comparison 109/110
First atom of 881 in first  selection 1/A/7 {GLY}/ N   altLoc :: segid :: pos: (31.7950,49.9730,50.8660) B-factor: 68.1800
First atom of 893 in second selection 1/B/6 {CYS}/ N   altLoc :: segid :: pos: (45.3620,34.2400,30.6710) B-factor: 84.3600
INFO:: LSQ matched 110 atoms
INFO:: 110 matched atoms had: 
   mean devi: 0.2048
    rms devi: 0.2651
    max devi: 1.1707
    min devi: 0.0160
   find_ncs_matrix returns (LSQ) 
|    0.5407,    0.4775,    0.6926|
|   -0.4862,   -0.4944,    0.7205|
|    0.6865,   -0.7263,  -0.03511|
(    -28.15,     65.89,      42.9)
   Adding ghost with name: NCS found from matching Chain B onto Chain A
INFO:: NCS chain comparison 109/110
First atom of 881 in first  selection 1/A/7 {GLY}/ N   altLoc :: segid :: pos: (31.7950,49.9730,50.8660) B-factor: 68.1800
First atom of 881 in second selection 1/C/7 {GLY}/ N   altLoc :: segid :: pos: (47.6640,58.9920,25.9960) B-factor: 67.7200
INFO:: LSQ matched 110 atoms
INFO:: 110 matched atoms had: 
   mean devi: 0.2275
    rms devi: 0.3035
    max devi: 1.6549
    min devi: 0.0661
   find_ncs_matrix returns (LSQ) 
|    0.5303,   -0.4851,    0.6953|
|    0.4758,   -0.5085,   -0.7177|
|    0.7017,    0.7114,  -0.03884|
(     18.19,     77.78,    -25.69)
   Adding ghost with name: NCS found from matching Chain C onto Chain A
INFO:: set_ncs_master_chain Constructed 2 ghosts
   Ghost info:: NCS found from matching Chain B onto Chain A
   Ghost info:: NCS found from matching Chain C onto Chain A
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_pdb1t6q.ent_Sat_Jan__6_07:50:37_2018_modification_1.pdb.gz
INFO:: backup file coot-backup/_lmb_home_pemsley_data_greg-data_pdb1t6q.ent_Sat_Jan__6_07:50:37_2018_modification_2.pdb.gz
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/pdb1hvv.ent
 PDB file /lmb/home/pemsley/data/greg-data/pdb1hvv.ent has been read.
Spacegroup: P 31 2 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 1 biomt matrices
INFO:: NCS chain comparison 62/67
INFO:: NCS chain comparison 66/67
INFO:: NCS chain comparison 61/67
INFO:: NCS chain comparison 0/67
  INFO:: fill_ghost_info Constructed 3 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
      Ghost 1 name: "NCS found from matching Chain C onto Chain A"
      Ghost 2 name: "NCS found from matching Chain D onto Chain A"
Molecule 154 read successfully
DEBUG:: there were 0 types with no dictionary 
DEBUG ncs_control_change_ncs_master_to_chain_id imol: 154 and chain_id: B
   %%%%%% add_ncs_ghosts_using_ncs_master 
   %%%%%% imaster: 1
   Checking chains for NCS matching to chain B
INFO:: NCS chain comparison 62/62
First atom of 506 in first  selection 1/B/193 {SER}/ N   altLoc :: segid :: pos: (0.5700,-74.7200,-82.8480) B-factor: 88.5200
First atom of 540 in second selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (-13.5350,-64.4380,-56.9280) B-factor: 45.2600
INFO:: LSQ matched 62 atoms
INFO:: 62 matched atoms had: 
   mean devi: 2.4989
    rms devi: 2.7962
    max devi: 6.6860
    min devi: 0.4401
   find_ncs_matrix returns (LSQ) 
|    0.7026,    0.1278,       0.7|
|    0.6024,    0.4169,   -0.6807|
|   -0.3788,    0.8999,    0.2159|
(     62.25,    -87.53,    -9.128)
   Adding ghost with name: NCS found from matching Chain A onto Chain B
INFO:: NCS chain comparison 62/62
First atom of 506 in first  selection 1/B/193 {SER}/ N   altLoc :: segid :: pos: (0.5700,-74.7200,-82.8480) B-factor: 88.5200
First atom of 535 in second selection 1/C/190 {GLN}/ N   altLoc :: segid :: pos: (63.7260,-15.7090,-72.8850) B-factor: 50.7600
INFO:: LSQ matched 62 atoms
INFO:: 62 matched atoms had: 
   mean devi: 2.6728
    rms devi: 2.9369
    max devi: 6.1200
    min devi: 0.2483
   find_ncs_matrix returns (LSQ) 
|   -0.3504,   -0.8022,   -0.4834|
|   -0.7587,  -0.05952,    0.6488|
|   -0.5492,     0.594,   -0.5878|
(    -29.05,     14.61,    -72.53)
   Adding ghost with name: NCS found from matching Chain C onto Chain B
INFO:: NCS chain comparison 61/62
First atom of 506 in first  selection 1/B/193 {SER}/ N   altLoc :: segid :: pos: (0.5700,-74.7200,-82.8480) B-factor: 88.5200
First atom of 497 in second selection 1/D/193 {SER}/ N   altLoc :: segid :: pos: (62.9170,-35.9890,-55.9290) B-factor: 78.3500
INFO:: LSQ matched 61 atoms
INFO:: 61 matched atoms had: 
   mean devi: 1.7317
    rms devi: 1.9769
    max devi: 7.9453
    min devi: 0.5297
   find_ncs_matrix returns (LSQ) 
|   -0.3815,   -0.9208,  -0.08098|
|   -0.9191,    0.3685,    0.1396|
|  -0.09874,    0.1277,   -0.9869|
(    -11.18,     4.757,    -127.2)
   Adding ghost with name: NCS found from matching Chain D onto Chain B
INFO:: NCS chain comparison 0/62
INFO:: set_ncs_master_chain Constructed 3 ghosts
   Ghost info:: NCS found from matching Chain A onto Chain B
   Ghost info:: NCS found from matching Chain C onto Chain B
   Ghost info:: NCS found from matching Chain D onto Chain B
INFO:: NCS chain comparison 62/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (-13.5350,-64.4380,-56.9280) B-factor: 45.2600
First atom of 506 in second selection 1/B/193 {SER}/ N   altLoc :: segid :: pos: (0.5700,-74.7200,-82.8480) B-factor: 88.5200
INFO:: LSQ matched 62 atoms
INFO:: 62 matched atoms had: 
   mean devi: 2.4989
    rms devi: 2.7962
    max devi: 6.6860
    min devi: 0.4401
   find_ncs_matrix returns (LSQ) 
|    0.7026,    0.6024,   -0.3788|
|    0.1278,    0.4169,    0.8999|
|       0.7,   -0.6807,    0.2159|
(     5.528,     36.75,    -101.2)
INFO:: NCS chain comparison 66/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (-13.5350,-64.4380,-56.9280) B-factor: 45.2600
First atom of 535 in second selection 1/C/190 {GLN}/ N   altLoc :: segid :: pos: (63.7260,-15.7090,-72.8850) B-factor: 50.7600
INFO:: LSQ matched 66 atoms
INFO:: 66 matched atoms had: 
   mean devi: 1.9713
    rms devi: 2.1729
    max devi: 4.5411
    min devi: 0.4295
   find_ncs_matrix returns (LSQ) 
|   -0.4445,   -0.8903,  -0.09887|
|    -0.893,    0.4317,    0.1271|
|  -0.07049,    0.1448,   -0.9869|
(    -8.624,     7.402,    -127.7)
INFO:: NCS chain comparison 61/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (-13.5350,-64.4380,-56.9280) B-factor: 45.2600
First atom of 497 in second selection 1/D/193 {SER}/ N   altLoc :: segid :: pos: (62.9170,-35.9890,-55.9290) B-factor: 78.3500
INFO:: LSQ matched 61 atoms
INFO:: 61 matched atoms had: 
   mean devi: 3.7042
    rms devi: 4.0859
    max devi: 9.4383
    min devi: 0.2858
   find_ncs_matrix returns (LSQ) 
|   -0.7198,   -0.6079,    0.3353|
|   -0.5986,    0.2989,   -0.7432|
|    0.3516,   -0.7356,    -0.579|
(     36.14,     -61.4,    -149.3)
INFO:: NCS chain comparison 0/67
  INFO:: fill_ghost_info Constructed 3 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
      Ghost 1 name: "NCS found from matching Chain C onto Chain A"
      Ghost 2 name: "NCS found from matching Chain D onto Chain A"
INFO:: Matching/moving molecule number 155 to 154
INFO:: LSQ matched 44 atoms
INFO:: 44 matched atoms had: 
   mean devi: 0.2239
    rms devi: 0.2350
    max devi: 0.3369
    min devi: 0.0588
INFO:: Axis orientation: (    0.7368,    0.6481,    0.1925)
INFO:: Rotation in CCP4 Polar Angles: Polar = (78.9031,41.336,116.426)
INFO:: backup file coot-backup/Copy_of__lmb_home_pemsley_data_greg-data_pdb1hvv.ent_Sat_Jan__6_07:50:53_2018_modification_0.pdb.gz
INFO:: coordinates transformed by orthogonal matrix: 
|    0.3395,    0.5177,    0.7853|
|    0.8624,     0.162,   -0.4796|
|   -0.3755,    0.8401,   -0.3915|
(     90.55,    -91.12,    -47.52)
INFO:: fractional coordinates matrix:
|    0.8374,    0.1106,    0.6656|
|    0.9958,   -0.3359,   -0.7249|
|   -0.2868,    0.6992,   -0.3915|
(    0.4296,    -1.191,    -0.411)
INFO:: NCS chain comparison 62/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (-13.5350,-64.4380,-56.9280) B-factor: 45.2600
First atom of 506 in second selection 1/B/193 {SER}/ N   altLoc :: segid :: pos: (0.5700,-74.7200,-82.8480) B-factor: 88.5200
INFO:: LSQ matched 62 atoms
INFO:: 62 matched atoms had: 
   mean devi: 2.4989
    rms devi: 2.7962
    max devi: 6.6860
    min devi: 0.4401
   find_ncs_matrix returns (LSQ) 
|    0.7026,    0.6024,   -0.3788|
|    0.1278,    0.4169,    0.8999|
|       0.7,   -0.6807,    0.2159|
(     5.528,     36.75,    -101.2)
INFO:: NCS chain comparison 66/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (-13.5350,-64.4380,-56.9280) B-factor: 45.2600
First atom of 535 in second selection 1/C/190 {GLN}/ N   altLoc :: segid :: pos: (63.7260,-15.7090,-72.8850) B-factor: 50.7600
INFO:: LSQ matched 66 atoms
INFO:: 66 matched atoms had: 
   mean devi: 1.9713
    rms devi: 2.1729
    max devi: 4.5411
    min devi: 0.4295
   find_ncs_matrix returns (LSQ) 
|   -0.4445,   -0.8903,  -0.09887|
|    -0.893,    0.4317,    0.1271|
|  -0.07049,    0.1448,   -0.9869|
(    -8.624,     7.402,    -127.7)
INFO:: NCS chain comparison 61/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (-13.5350,-64.4380,-56.9280) B-factor: 45.2600
First atom of 497 in second selection 1/D/193 {SER}/ N   altLoc :: segid :: pos: (62.9170,-35.9890,-55.9290) B-factor: 78.3500
INFO:: LSQ matched 61 atoms
INFO:: 61 matched atoms had: 
   mean devi: 3.7042
    rms devi: 4.0859
    max devi: 9.4383
    min devi: 0.2858
   find_ncs_matrix returns (LSQ) 
|   -0.7198,   -0.6079,    0.3353|
|   -0.5986,    0.2989,   -0.7432|
|    0.3516,   -0.7356,    -0.579|
(     36.14,     -61.4,    -149.3)
INFO:: NCS chain comparison 0/67
  INFO:: fill_ghost_info Constructed 3 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
      Ghost 1 name: "NCS found from matching Chain C onto Chain A"
      Ghost 2 name: "NCS found from matching Chain D onto Chain A"
INFO:: Matching/moving molecule number 156 to 154
INFO:: LSQ matched 44 atoms
INFO:: 44 matched atoms had: 
   mean devi: 0.1943
    rms devi: 0.2112
    max devi: 0.3583
    min devi: 0.0329
INFO:: Axis orientation: (    -0.431,    0.3986,    0.8095)
INFO:: Rotation in CCP4 Polar Angles: Polar = (144.051,-42.7613,171.905)
INFO:: backup file coot-backup/Copy_of__lmb_home_pemsley_data_greg-data_pdb1hvv.ent_Sat_Jan__6_07:50:53_2018_modification_0.pdb.gz
INFO:: coordinates transformed by orthogonal matrix: 
|   -0.6203,   -0.2279,   -0.7505|
|   -0.4559,   -0.6739,    0.5814|
|   -0.6382,    0.7028,    0.3141|
(    -22.14,    -19.93,     1.626)
INFO:: fractional coordinates matrix:
|   -0.8835,  -0.09252,    -0.543|
|   -0.5264,   -0.4107,    0.8789|
|   -0.4875,    0.7087,    0.3141|
(    -0.381,   -0.2605,   0.01406)
INFO:: NCS chain comparison 62/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (-13.5350,-64.4380,-56.9280) B-factor: 45.2600
First atom of 506 in second selection 1/B/193 {SER}/ N   altLoc :: segid :: pos: (0.5700,-74.7200,-82.8480) B-factor: 88.5200
INFO:: LSQ matched 62 atoms
INFO:: 62 matched atoms had: 
   mean devi: 2.4989
    rms devi: 2.7962
    max devi: 6.6860
    min devi: 0.4401
   find_ncs_matrix returns (LSQ) 
|    0.7026,    0.6024,   -0.3788|
|    0.1278,    0.4169,    0.8999|
|       0.7,   -0.6807,    0.2159|
(     5.528,     36.75,    -101.2)
INFO:: NCS chain comparison 66/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (-13.5350,-64.4380,-56.9280) B-factor: 45.2600
First atom of 535 in second selection 1/C/190 {GLN}/ N   altLoc :: segid :: pos: (63.7260,-15.7090,-72.8850) B-factor: 50.7600
INFO:: LSQ matched 66 atoms
INFO:: 66 matched atoms had: 
   mean devi: 1.9713
    rms devi: 2.1729
    max devi: 4.5411
    min devi: 0.4295
   find_ncs_matrix returns (LSQ) 
|   -0.4445,   -0.8903,  -0.09887|
|    -0.893,    0.4317,    0.1271|
|  -0.07049,    0.1448,   -0.9869|
(    -8.624,     7.402,    -127.7)
INFO:: NCS chain comparison 61/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (-13.5350,-64.4380,-56.9280) B-factor: 45.2600
First atom of 497 in second selection 1/D/193 {SER}/ N   altLoc :: segid :: pos: (62.9170,-35.9890,-55.9290) B-factor: 78.3500
INFO:: LSQ matched 61 atoms
INFO:: 61 matched atoms had: 
   mean devi: 3.7042
    rms devi: 4.0859
    max devi: 9.4383
    min devi: 0.2858
   find_ncs_matrix returns (LSQ) 
|   -0.7198,   -0.6079,    0.3353|
|   -0.5986,    0.2989,   -0.7432|
|    0.3516,   -0.7356,    -0.579|
(     36.14,     -61.4,    -149.3)
INFO:: NCS chain comparison 0/67
  INFO:: fill_ghost_info Constructed 3 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
      Ghost 1 name: "NCS found from matching Chain C onto Chain A"
      Ghost 2 name: "NCS found from matching Chain D onto Chain A"
INFO:: Matching/moving molecule number 157 to 154
INFO:: LSQ matched 44 atoms
INFO:: 44 matched atoms had: 
   mean devi: 0.4174
    rms devi: 0.4531
    max devi: 0.7926
    min devi: 0.0759
INFO:: Axis orientation: (    0.6231,   -0.7786,  -0.07411)
INFO:: Rotation in CCP4 Polar Angles: Polar = (85.7498,128.67,177.232)
INFO:: backup file coot-backup/Copy_of__lmb_home_pemsley_data_greg-data_pdb1hvv.ent_Sat_Jan__6_07:50:53_2018_modification_0.pdb.gz
INFO:: coordinates transformed by orthogonal matrix: 
|   -0.2227,   -0.9733,  -0.05471|
|   -0.9662,    0.2129,    0.1454|
|   -0.1299,   0.08525,   -0.9879|
(    -15.82,   -0.3228,      -130)
INFO:: fractional coordinates matrix:
|   -0.7806,   -0.3462,   0.03831|
|    -1.116,    0.7707,    0.2198|
|  -0.09924,     0.106,   -0.9879|
(   -0.1813,  -0.00422,    -1.125)
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/pdb1hvv.ent
 PDB file /lmb/home/pemsley/data/greg-data/pdb1hvv.ent has been read.
Spacegroup: P 31 2 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 1 biomt matrices
INFO:: NCS chain comparison 62/67
INFO:: NCS chain comparison 66/67
INFO:: NCS chain comparison 61/67
INFO:: NCS chain comparison 0/67
  INFO:: fill_ghost_info Constructed 3 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
      Ghost 1 name: "NCS found from matching Chain C onto Chain A"
      Ghost 2 name: "NCS found from matching Chain D onto Chain A"
Molecule 158 read successfully
DEBUG:: there were 0 types with no dictionary 
INFO:: making map from mtz filename /lmb/home/pemsley/data/greg-data/1hvv_sigmaa.mtz
Number of OBSERVED reflections: 20903
INFO:: finding ASU unique map points with sampling rate 1.5000
INFO grid sampling...Nuvw = ( 112, 112, 150)
INFO:: 0.0510 seconds to read MTZ file
INFO:: 0.0280 seconds to initialize map
INFO:: 0.0360 seconds for FFT
INFO:: 0.0050 seconds for statistics
      Map mean: ........ -0.0000
      Map sigma: ....... 0.2241
      Map maximum: ..... 1.7219
      Map minimum: ..... -0.8818
INFO:: 0.0310 seconds for contour map
INFO:: 0.1510 seconds in total
INFO:: NCS chain comparison 62/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (-13.5350,-64.4380,-56.9280) B-factor: 45.2600
First atom of 506 in second selection 1/B/193 {SER}/ N   altLoc :: segid :: pos: (0.5700,-74.7200,-82.8480) B-factor: 88.5200
INFO:: LSQ matched 62 atoms
INFO:: 62 matched atoms had: 
   mean devi: 2.4989
    rms devi: 2.7962
    max devi: 6.6860
    min devi: 0.4401
   find_ncs_matrix returns (LSQ) 
|    0.7026,    0.6024,   -0.3788|
|    0.1278,    0.4169,    0.8999|
|       0.7,   -0.6807,    0.2159|
(     5.528,     36.75,    -101.2)
INFO:: NCS chain comparison 66/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (-13.5350,-64.4380,-56.9280) B-factor: 45.2600
First atom of 535 in second selection 1/C/190 {GLN}/ N   altLoc :: segid :: pos: (63.7260,-15.7090,-72.8850) B-factor: 50.7600
INFO:: LSQ matched 66 atoms
INFO:: 66 matched atoms had: 
   mean devi: 1.9713
    rms devi: 2.1729
    max devi: 4.5411
    min devi: 0.4295
   find_ncs_matrix returns (LSQ) 
|   -0.4445,   -0.8903,  -0.09887|
|    -0.893,    0.4317,    0.1271|
|  -0.07049,    0.1448,   -0.9869|
(    -8.624,     7.402,    -127.7)
INFO:: NCS chain comparison 61/67
First atom of 540 in first  selection 1/A/190 {GLN}/ N   altLoc :: segid :: pos: (-13.5350,-64.4380,-56.9280) B-factor: 45.2600
First atom of 497 in second selection 1/D/193 {SER}/ N   altLoc :: segid :: pos: (62.9170,-35.9890,-55.9290) B-factor: 78.3500
INFO:: LSQ matched 61 atoms
INFO:: 61 matched atoms had: 
   mean devi: 3.7042
    rms devi: 4.0859
    max devi: 9.4383
    min devi: 0.2858
   find_ncs_matrix returns (LSQ) 
|   -0.7198,   -0.6079,    0.3353|
|   -0.5986,    0.2989,   -0.7432|
|    0.3516,   -0.7356,    -0.579|
(     36.14,     -61.4,    -149.3)
INFO:: NCS chain comparison 0/67
  INFO:: fill_ghost_info Constructed 3 ghosts
      Ghost 0 name: "NCS found from matching Chain B onto Chain A"
      Ghost 1 name: "NCS found from matching Chain C onto Chain A"
      Ghost 2 name: "NCS found from matching Chain D onto Chain A"
INFO:: installing ghost map with name :Map 159 NCS found from matching Chain B onto Chain A
Done install_ghost_map
INFO:: installing ghost map with name :Map 159 NCS found from matching Chain C onto Chain A
Done install_ghost_map
INFO:: installing ghost map with name :Map 159 NCS found from matching Chain D onto Chain A
Done install_ghost_map
Reference matcher: 0 and 0
|    0.7026,    0.6024,   -0.3788|
|    0.1278,    0.4169,    0.8999|
|       0.7,   -0.6807,    0.2159|
(     5.528,     36.75,    -101.2)
inverse of reference matcher transformation:
|    0.7026,    0.1278,       0.7|
|    0.6024,    0.4169,   -0.6807|
|   -0.3788,    0.8999,    0.2159|
(     62.25,    -87.53,    -9.128)
boxing over uvw = (   -0.7364,   -0.9448,    -0.679) to uvw = (    0.7947,   0.04686,   -0.4302)
Reference matcher: 0 and 1
|   -0.4445,   -0.8903,  -0.09887|
|    -0.893,    0.4317,    0.1271|
|  -0.07049,    0.1448,   -0.9869|
(    -8.624,     7.402,    -127.7)
inverse of reference matcher transformation:
|   -0.4445,    -0.893,  -0.07049|
|   -0.8903,    0.4317,    0.1448|
|  -0.09887,    0.1271,   -0.9869|
(    -6.223,     7.613,    -127.8)
boxing over uvw = (   -0.7364,   -0.9448,    -0.679) to uvw = (    0.7947,   0.04686,   -0.4302)
Reference matcher: 0 and 2
|   -0.7198,   -0.6079,    0.3353|
|   -0.5986,    0.2989,   -0.7432|
|    0.3516,   -0.7356,    -0.579|
(     36.14,     -61.4,    -149.3)
inverse of reference matcher transformation:
|   -0.7198,   -0.5986,    0.3516|
|   -0.6079,    0.2989,   -0.7356|
|    0.3353,   -0.7432,    -0.579|
(     41.75,    -69.53,    -144.2)
boxing over uvw = (   -0.7364,   -0.9448,    -0.679) to uvw = (    0.7947,   0.04686,   -0.4302)
INFO:: There were 4.0000 maps contributing to the average
INFO:: rescaling by 0.2500
INFO:: 313712 out of 313712 (100.0000%) map points  were masked out of NCS average target volume,  chain A
INFO:: made 1 averaged map(s)
Map statistics: mean: -0.0008 st.d: 0.1767
Map statistics: min: -0.9977, max: 1.4866
   -0.9667    1
   -0.9046    3
   -0.8424    8
   -0.7803    10
   -0.7182    37
   -0.6561    102
   -0.5940    196
   -0.5319    490
   -0.4698    1190
   -0.4077    2390
   -0.3456    4703
   -0.2835    8981
   -0.2214    16028
   -0.1593    27796
   -0.0972    44285
   -0.0351    60780
    0.0271    53651
    0.0892    32327
    0.1513    21048
    0.2134    14284
    0.2755    9269
    0.3376    5945
    0.3997    3629
    0.4618    2439
    0.5239    1480
    0.5860    942
    0.6481    569
    0.7102    378
    0.7723    239
    0.8344    166
    0.8965    112
    0.9587    94
    1.0208    50
    1.0829    35
    1.1450    21
    1.2071    17
    1.2692    5
    1.3313    4
    1.3934    5
    1.4555    3
    1.5176    0
INFO:: installing ghost map with name :Map 159 NCS found from matching Chain B onto Chain A
Done install_ghost_map
INFO:: installing ghost map with name :Map 159 NCS found from matching Chain C onto Chain A
Done install_ghost_map
INFO:: installing ghost map with name :Map 159 NCS found from matching Chain D onto Chain A
Done install_ghost_map
Reference matcher: 0 and 0
|    0.7026,    0.6024,   -0.3788|
|    0.1278,    0.4169,    0.8999|
|       0.7,   -0.6807,    0.2159|
(     5.528,     36.75,    -101.2)
inverse of reference matcher transformation:
|    0.7026,    0.1278,       0.7|
|    0.6024,    0.4169,   -0.6807|
|   -0.3788,    0.8999,    0.2159|
(     62.25,    -87.53,    -9.128)
boxing over uvw = (   -0.7364,   -0.9448,    -0.679) to uvw = (    0.7947,   0.04686,   -0.4302)
Reference matcher: 0 and 1
|   -0.4445,   -0.8903,  -0.09887|
|    -0.893,    0.4317,    0.1271|
|  -0.07049,    0.1448,   -0.9869|
(    -8.624,     7.402,    -127.7)
inverse of reference matcher transformation:
|   -0.4445,    -0.893,  -0.07049|
|   -0.8903,    0.4317,    0.1448|
|  -0.09887,    0.1271,   -0.9869|
(    -6.223,     7.613,    -127.8)
boxing over uvw = (   -0.7364,   -0.9448,    -0.679) to uvw = (    0.7947,   0.04686,   -0.4302)
Reference matcher: 0 and 2
|   -0.7198,   -0.6079,    0.3353|
|   -0.5986,    0.2989,   -0.7432|
|    0.3516,   -0.7356,    -0.579|
(     36.14,     -61.4,    -149.3)
inverse of reference matcher transformation:
|   -0.7198,   -0.5986,    0.3516|
|   -0.6079,    0.2989,   -0.7356|
|    0.3353,   -0.7432,    -0.579|
(     41.75,    -69.53,    -144.2)
boxing over uvw = (   -0.7364,   -0.9448,    -0.679) to uvw = (    0.7947,   0.04686,   -0.4302)
INFO:: There were 4.0000 maps contributing to the average
INFO:: rescaling by 0.2500
INFO:: 313712 out of 313712 (100.0000%) map points  were masked out of NCS average target volume,  chain A
INFO:: made 1 averaged map(s)
Map statistics: mean: -0.0008 st.d: 0.1767
Map statistics: min: -0.9977, max: 1.4866
   -0.9667    1
   -0.9046    3
   -0.8424    8
   -0.7803    10
   -0.7182    37
   -0.6561    102
   -0.5940    196
   -0.5319    490
   -0.4698    1190
   -0.4077    2390
   -0.3456    4703
   -0.2835    8981
   -0.2214    16028
   -0.1593    27796
   -0.0972    44285
   -0.0351    60780
    0.0271    53651
    0.0892    32327
    0.1513    21048
    0.2134    14284
    0.2755    9269
    0.3376    5945
    0.3997    3629
    0.4618    2439
    0.5239    1480
    0.5860    942
    0.6481    569
    0.7102    378
    0.7723    239
    0.8344    166
    0.8965    112
    0.9587    94
    1.0208    50
    1.0829    35
    1.1450    21
    1.2071    17
    1.2692    5
    1.3313    4
    1.3934    5
    1.4555    3
    1.5176    0
INFO:: installing ghost map with name :Map 159 NCS found from matching Chain B onto Chain A
Done install_ghost_map
INFO:: installing ghost map with name :Map 159 NCS found from matching Chain C onto Chain A
Done install_ghost_map
INFO:: installing ghost map with name :Map 159 NCS found from matching Chain D onto Chain A
Done install_ghost_map
Reference matcher: 0 and 0
|    0.7026,    0.6024,   -0.3788|
|    0.1278,    0.4169,    0.8999|
|       0.7,   -0.6807,    0.2159|
(     5.528,     36.75,    -101.2)
inverse of reference matcher transformation:
|    0.7026,    0.1278,       0.7|
|    0.6024,    0.4169,   -0.6807|
|   -0.3788,    0.8999,    0.2159|
(     62.25,    -87.53,    -9.128)
boxing over uvw = (   -0.7364,   -0.9448,    -0.679) to uvw = (    0.7947,   0.04686,   -0.4302)
Reference matcher: 0 and 1
|   -0.4445,   -0.8903,  -0.09887|
|    -0.893,    0.4317,    0.1271|
|  -0.07049,    0.1448,   -0.9869|
(    -8.624,     7.402,    -127.7)
inverse of reference matcher transformation:
|   -0.4445,    -0.893,  -0.07049|
|   -0.8903,    0.4317,    0.1448|
|  -0.09887,    0.1271,   -0.9869|
(    -6.223,     7.613,    -127.8)
boxing over uvw = (   -0.7364,   -0.9448,    -0.679) to uvw = (    0.7947,   0.04686,   -0.4302)
Reference matcher: 0 and 2
|   -0.7198,   -0.6079,    0.3353|
|   -0.5986,    0.2989,   -0.7432|
|    0.3516,   -0.7356,    -0.579|
(     36.14,     -61.4,    -149.3)
inverse of reference matcher transformation:
|   -0.7198,   -0.5986,    0.3516|
|   -0.6079,    0.2989,   -0.7356|
|    0.3353,   -0.7432,    -0.579|
(     41.75,    -69.53,    -144.2)
boxing over uvw = (   -0.7364,   -0.9448,    -0.679) to uvw = (    0.7947,   0.04686,   -0.4302)
INFO:: There were 4.0000 maps contributing to the average
INFO:: rescaling by 0.2500
INFO:: 313712 out of 313712 (100.0000%) map points  were masked out of NCS average target volume,  chain A
INFO:: made 1 averaged map(s)
Map statistics: mean: -0.0008 st.d: 0.1767
Map statistics: min: -0.9977, max: 1.4866
   -0.9667    1
   -0.9046    3
   -0.8424    8
   -0.7803    10
   -0.7182    37
   -0.6561    102
   -0.5940    196
   -0.5319    490
   -0.4698    1190
   -0.4077    2390
   -0.3456    4703
   -0.2835    8981
   -0.2214    16028
   -0.1593    27796
   -0.0972    44285
   -0.0351    60780
    0.0271    53651
    0.0892    32327
    0.1513    21048
    0.2134    14284
    0.2755    9269
    0.3376    5945
    0.3997    3629
    0.4618    2439
    0.5239    1480
    0.5860    942
    0.6481    569
    0.7102    378
    0.7723    239
    0.8344    166
    0.8965    112
    0.9587    94
    1.0208    50
    1.0829    35
    1.1450    21
    1.2071    17
    1.2692    5
    1.3313    4
    1.3934    5
    1.4555    3
    1.5176    0
error (syntax error)
error (syntax error)
error (not syntax error)
Traceback (most recent call last):
  File "<string>", line 1, in <module>
NameError: name 'rr_not_found_thing' is not defined
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/monomer-ACT.pdb
 PDB file /lmb/home/pemsley/data/greg-data/monomer-ACT.pdb has been read.
Spacegroup: P 1
INFO:: Found 1 models
   Model 1 had 0 links
in add_molecular_symmetry_matrices() made 0 biomt matrices
Molecule 168 read successfully
DEBUG:: there were 0 types with no dictionary 
Entering test: OXT in restraints?
INFO:: Using Standard CCP4 Refmac dictionary from CLIBD_MON: /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/
There are 142 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/list/mon_lib_list.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/a/ALA.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/a/ASP.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/a/ASN.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/c/CYS.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/g/GLN.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/g/GLY.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/g/GLU.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/p/PHE.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/h/HIS.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/i/ILE.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/l/LYS.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/l/LEU.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/m/MET.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/m/MSE.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/p/PRO.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/a/ARG.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/s/SER.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/t/THR.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/v/VAL.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/t/TRP.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/t/TYR.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/p/PO4.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/s/SO4.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/g/GOL.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/c/CIT.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/e/EDO.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/a/A.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/c/C.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/g/G.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/u/U.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/d/DA.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/d/DC.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/d/DG.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/d/DT.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/h/HOH.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/n/NA.cif
There are 2 data in /lmb/home/pemsley/data/greg-data/libcheck_BCS.cif
PASS: OXT in restraints?
Entering test: Relative file name
PASS: Relative file name
Entering test: geometry distortion comparision
    Good gdi < exception thrown
    Good gdi > exception thrown
PASS: geometry distortion comparision
Entering test: test symm trans to origin
    Got length 0.1414
PASS: test symm trans to origin
Entering test: test lsq plane
LSQ deviations: 0.0000 0.0000
PASS: test lsq plane
Entering test: test COO modification
INFO:: Using Standard CCP4 Refmac dictionary from CLIBD_MON: /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/
There are 142 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/list/mon_lib_list.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/a/ALA.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/a/ASP.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/a/ASN.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/c/CYS.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/g/GLN.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/g/GLY.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/g/GLU.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/p/PHE.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/h/HIS.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/i/ILE.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/l/LYS.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/l/LEU.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/m/MET.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/m/MSE.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/p/PRO.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/a/ARG.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/s/SER.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/t/THR.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/v/VAL.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/t/TRP.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/t/TYR.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/p/PO4.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/s/SO4.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/g/GOL.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/c/CIT.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/e/EDO.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/a/A.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/c/C.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/g/G.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/u/U.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/d/DA.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/d/DC.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/d/DG.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/d/DT.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/h/HOH.cif
There are 2 data in /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/n/NA.cif
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/hideous-OXT.pdb
 PDB file /lmb/home/pemsley/data/greg-data/hideous-OXT.pdb has been read.
Spacegroup: P 21 21 21
read 9 atom 
created 7 bond       restraints 
created 8 angle      restraints 
created 1 plane      restraints 
created 1 chiral vol restraints 
created 2 torsion restraints 
created 23 restraints

INFO:: make_restraints(): made 13 non-bonded restraints
initial distortion_score: 1241.5407
    Initial RMS Z values
bonds:      3.7208
angles:     7.4688
torsions:   0.2764
planes:     16.9011
non-bonded: 0.0000
chiral vol: 1.2266
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
Minimum found (iteration number 243) at 0.0349
    Final Estimated RMS Z Scores:
bonds:      0.0017
angles:     0.0239
torsions:   0.1205
planes:     0.0019
non-bonded: 0.0000
chiral vol: 0.0068
rama plot:  N/A 
start_pos:  N/A 
GemanMcCl:  N/A 
refinement_took 0.0070 seconds
OXT out of plane distance: 0.0000
OXT->O distance: 2.1104
PASS: test COO modification
Entering test: remove whitespace
PASS: remove whitespace
Entering test: New comp_ids are sane
PASS: New comp_ids are sane
Entering test: Remove Trailing Slash
PASS: Remove Trailing Slash
Entering test: Residues for phi,psi are close enough to be considered linked
INFO:: Reading coordinate file: /lmb/home/pemsley/data/greg-data/frag-2wot.pdb
 PDB file /lmb/home/pemsley/data/greg-data/frag-2wot.pdb has been read.
Spacegroup: P 21 21 21
bad residues for phi,psi calculation
bad residues for phi,psi calculation
PASS: Residues for phi,psi are close enough to be considered linked
PASS: LSQ by atom
Entered testcase - LSQing changes the space-group and cell to that of the reference molecule
PASS: LSQing changes the space-group and cell to that of the reference molecule
Entered testcase - set-residue-name sets the correct residue
PASS: set-residue-name sets the correct residue
Entered testcase - fit-protein-make-specs makes all specs
   specs: 189 ((94 "A" 1 "") (94 "A" 2 "") (94 "A" 3 "") (94 "A" 4 "") (94 "A" 5 "") (94 "A" 6 "") (94 "A" 7 "") (94 "A" 8 "") (94 "A" 9 "") (94 "A" 10 "") (94 "A" 11 "") (94 "A" 12 "") (94 "A" 13 "") (94 "A" 14 "") (94 "A" 15 "") (94 "A" 16 "") (94 "A" 17 "") (94 "A" 18 "") (94 "A" 19 "") (94 "A" 20 "") (94 "A" 21 "") (94 "A" 22 "") (94 "A" 23 "") (94 "A" 24 "") (94 "A" 25 "") (94 "A" 26 "") (94 "A" 27 "") (94 "A" 28 "") (94 "A" 29 "") (94 "A" 30 "") (94 "A" 31 "") (94 "A" 32 "") (94 "A" 33 "") (94 "A" 34 "") (94 "A" 35 "") (94 "A" 36 "") (94 "A" 37 "") (94 "A" 38 "") (94 "A" 39 "") (94 "A" 40 "") (94 "A" 41 "") (94 "A" 42 "") (94 "A" 43 "") (94 "A" 44 "") (94 "A" 45 "") (94 "A" 46 "") (94 "A" 47 "") (94 "A" 48 "") (94 "A" 49 "") (94 "A" 50 "") (94 "A" 51 "") (94 "A" 52 "") (94 "A" 53 "") (94 "A" 54 "") (94 "A" 55 "") (94 "A" 56 "") (94 "A" 57 "") (94 "A" 58 "") (94 "A" 59 "") (94 "A" 60 "") (94 "A" 61 "") (94 "A" 62 "") (94 "A" 63 "") (94 "A" 64 "") (94 "A" 65 "") (94 "A" 66 "") (94 "A" 67 "") (94 "A" 68 "") (94 "A" 69 "") (94 "A" 70 "") (94 "A" 71 "") (94 "A" 72 "") (94 "A" 73 "") (94 "A" 74 "") (94 "A" 75 "") (94 "A" 76 "") (94 "A" 77 "") (94 "A" 78 "") (94 "A" 79 "") (94 "A" 80 "") (94 "A" 81 "") (94 "A" 82 "") (94 "A" 83 "") (94 "A" 84 "") (94 "A" 85 "") (94 "A" 86 "") (94 "A" 87 "") (94 "A" 88 "") (94 "A" 89 "") (94 "A" 90 "") (94 "A" 91 "") (94 "A" 92 "") (94 "A" 93 "") (94 "B" 1 "") (94 "B" 2 "") (94 "B" 3 "") (94 "B" 4 "") (94 "B" 5 "") (94 "B" 6 "") (94 "B" 7 "") (94 "B" 8 "") (94 "B" 9 "") (94 "B" 10 "") (94 "B" 11 "") (94 "B" 12 "") (94 "B" 13 "") (94 "B" 14 "") (94 "B" 15 "") (94 "B" 16 "") (94 "B" 17 "") (94 "B" 18 "") (94 "B" 19 "") (94 "B" 20 "") (94 "B" 21 "") (94 "B" 22 "") (94 "B" 23 "") (94 "B" 24 "") (94 "B" 25 "") (94 "B" 26 "") (94 "B" 27 "") (94 "B" 28 "") (94 "B" 29 "") (94 "B" 30 "") (94 "B" 31 "") (94 "B" 32 "") (94 "B" 33 "") (94 "B" 34 "") (94 "B" 35 "") (94 "B" 36 "") (94 "B" 37 "") (94 "B" 38 "") (94 "B" 39 "") (94 "B" 40 "") (94 "B" 41 "") (94 "B" 42 "") (94 "B" 43 "") (94 "B" 44 "") (94 "B" 45 "") (94 "B" 46 "") (94 "B" 47 "") (94 "B" 48 "") (94 "B" 49 "") (94 "B" 50 "") (94 "B" 51 "") (94 "B" 52 "") (94 "B" 53 "") (94 "B" 54 "") (94 "B" 55 "") (94 "B" 56 "") (94 "B" 57 "") (94 "B" 58 "") (94 "B" 59 "") (94 "B" 60 "") (94 "B" 61 "") (94 "B" 62 "") (94 "B" 63 "") (94 "B" 64 "") (94 "B" 65 "") (94 "B" 66 "") (94 "B" 67 "") (94 "B" 68 "") (94 "B" 69 "") (94 "B" 70 "") (94 "B" 71 "") (94 "B" 72 "") (94 "B" 73 "") (94 "B" 74 "") (94 "B" 75 "") (94 "B" 76 "") (94 "B" 77 "") (94 "B" 78 "") (94 "B" 79 "") (94 "B" 80 "") (94 "B" 81 "") (94 "B" 82 "") (94 "B" 83 "") (94 "B" 84 "") (94 "B" 85 "") (94 "B" 86 "") (94 "B" 87 "") (94 "B" 88 "") (94 "B" 89 "") (94 "B" 90 "") (94 "B" 91 "") (94 "B" 92 "") (94 "B" 93 "") (94 "B" 94 "") (94 "B" 95 "") (94 "B" 96 ""))
PASS: fit-protein-make-specs makes all specs
Entered testcase - Phosphate distance in pucker analysis is sane
PASS: Phosphate distance in pucker analysis is sane
Entered testcase - Fix for Oliver Clarke fit by atom selection bug
bl: 0.0363726829001203
PASS: Fix for Oliver Clarke fit by atom selection bug
Ended 01-pdb+mtz.scm
Running 02-shelx.scm ...
Entered testcase - Read small molecule .res file
PASS: Read small molecule .res file
Entered testcase - Read hollander small molecule .res file
PASS: Read hollander small molecule .res file
Entered testcase - read shelx insulin with fcf
PASS: read shelx insulin with fcf
Entered testcase - Write an INS from PDB test
PASS: Write an INS from PDB test
Entered testcase - new molecule by atom selection inherits shelx molecule flag
PASS: new molecule by atom selection inherits shelx molecule flag
Entered testcase - Addition of Terminal Residue on SHELX molecule has correct occupancy
PASS: Addition of Terminal Residue on SHELX molecule has correct occupancy
Entered testcase - Add water to SHELX molecule
PASS: Add water to SHELX molecule
Entered testcase - Find Waters for a SHELXL molecule
PASS: Find Waters for a SHELXL molecule
Entered testcase - NPD Anisotropic Atom [Mitch Miller]
PASS: NPD Anisotropic Atom [Mitch Miller]
Entered testcase - close shelx molecules
PASS: close shelx molecules
Entered testcase - Aniso Bs in P21
b-1: (3.50660848617554 0.0295678526163101 0.0602300018072128 0.043437298387289 5.61549968551844e-4 -0.00681614130735397 -0.0034269078169018) 
b-2: (3.50660848617554 0.0295678526163101 0.0602300018072128 0.043437298387289 5.61549968551844e-4 -0.00681614130735397 -0.0034269078169018) 
PASS: Aniso Bs in P21
Entered testcase - Don't crash on reading a strange HAT file
PASS: Don't crash on reading a strange HAT file
Ended 02-shelx.scm
Running 03-ligand.scm ...
Entered testcase - Get monomer test
run-command-in-dir dir: "coot-ccp4/" exe: "libcheck" cl-args: () data-lines: ("N" "MON 3GP" "") log-file-name: "coot-libcheck-3GP.log" #t
:
:  --- LIBCHECK --- /Vers 5.2.02  ; 02.12.2014/
:
:
:  Do you want to have FILE-DOCUMENT /libcheck.doc/ ? /<N>/Y/A :
:    N - means without DOC-file
:    Y - with new contents
:    A - means to keep old contents and add new information
:        with DOC-file program creates batch file: libcheck.bat
: _DOC:
:
: #
: #      Keywords:
: #
: #FILE_L:   < >  - additional library, " " means without this file
: #MON:      < >  - give info about this monomer
: #                 if = * , give list all monomers in the library
: #FILE_PDB: < >  - input PDB_file  ," " means without this file
: #FILE_SMILE: < >  - input SMILE_file  ," " means without this fil e
: #FILE_SDF:   < > - input SDF file, " " means without this file
: #FILE_MOL:   < > - input MOL (sybil), SDF, ODB (O) files
: #                   use keyword MON as compound_id
: #FILE_CIF: < >  - input CIFile    ," " means without this file
: #FILE_CSD: < >  - input CSD CIFile," " means without this file
: #HFLAG: <Y>/A/N - Y - hydrogen atoms where they are
: #                 A - with all hydrogen atoms
: #                 N - without hydrogen atoms
: #IND:    <N>/Y  - Y - create index of mon_lib.cif
: #                     output file: "new_mon_lib_ind.cif"
: #FILE_O: <libcheck > - output files /library,coords,ps/, name without
: #                      extention
: #FILE_L2:  < >  - additional library (FILE_L) will be added to this library
: #                 in this case program performs only adding
: #ANGLE:   <0.0> - rotation angle for picture ( around X )
: #LIST: <M>/S/L  - S short output, L - long, M - medium
: #REF:  <Y>/S,N,0 - 0 no refinement of new monomer
: #                  N only crd->ang and ang->crd
: #                  S plus torsion ref, Y plus restr.ref
: #
: #TEST:   <0>    - for program testing only
: #COOR: <N>/Y    - use Vobs from coords instead Videal
: #LCOOR: <Y>/N   - Y use coords from lib description
: #NODIST: <N>/Y  - Y not read the distributed library
: #                 (only with FILE_L)
: #SRCH: <N>/Y/0  - Y - global search, 0 - for MON from PDB_file
: #                 (only with NODIST = N)
:
: #---  type "keyword   parameters" and/or ---
: #---  press key "CR" to run program      ---
: --> --> MON   : 3GP
: -------------
: -------------
: Keywords:
: HFLAG : Y
: COOR  : N
: LCOOR : Y
: SRCH  : N
: REF   : Y
: NODIST: N
:  ------------------------------
:  ---  LIBRARY OF MONOMERS   ---
: _lib_name         mon_lib
: _lib_version      5.44
: _lib_update       30/05/14
:  ------------------------------
:  NUMBER OF MONOMERS IN THE LIBRARY          : 11617
:                with complete description    : 11617
:  NUMBER OF MODIFICATIONS                    :    63
:  NUMBER OF LINKS                            :    73
:  I am reading libraries. Please wait.
:      - energy parameters
:      - monomer"s description (links & mod )
:  I am reading library. Please wait.
:      - monomer"s description
:  WARNING: bond C4'  - C3'   delta (lib-coord) :   0.020
:  WARNING: bond C3'  - C2'   delta (lib-coord) :   0.023
:  WARNING: bond N9   - C8    delta (lib-coord) :   0.028
:  WARNING: bond N9   - C4    delta (lib-coord) :   0.030
:  WARNING: bond C8   - N7    delta (lib-coord) :   0.050
:  WARNING: bond C5   - C6    delta (lib-coord) :   0.075
:  WARNING: bond C5   - C4    delta (lib-coord) :   0.090
:  WARNING: bond C6   - O6    delta (lib-coord) :   0.031
:  WARNING: bond C2   - N1    delta (lib-coord) :   0.027
:  WARNING: bond N3   - C2    delta (lib-coord) :   0.036
:  WARNING: angle O4'  - C1'  - C2'   delta (lib-coord) :   4.463
:  WARNING: angle C1'  - O4'  - C4'   delta (lib-coord) :   6.546
:  WARNING: angle C1'  - C2'  - C3'   delta (lib-coord) :   7.042
:  WARNING: angle C2'  - C3'  - C4'   delta (lib-coord) :   6.948
:  WARNING: angle C3'  - O3'  - P     delta (lib-coord) :  13.628
:  WARNING: angle O3P  - P    - O2P   delta (lib-coord) :  10.426
:  WARNING: angle O3P  - P    - O1P   delta (lib-coord) :  10.379
:  WARNING: angle O2P  - P    - O1P   delta (lib-coord) :  10.383
:  WARNING: angle C3'  - C4'  - O4'   delta (lib-coord) :   4.651
:  WARNING: tors O6   - C6   - N1   - C2   delta (lib-coord) :   0.303
:  WARNING: tors C6   - N1   - C2   - N3   delta (lib-coord) :   0.636
:  WARNING: tors N1   - C2   - N2   - HN21 delta (lib-coord) :   0.000
:  WARNING: tors N1   - C2   - N3   - C4   delta (lib-coord) :   0.332
:  WARNING: tors C2   - N3   - C4   - N9   delta (lib-coord) :   0.079
:  WARNING: tors N3   - C4   - C5   - N7   delta (lib-coord) :   0.034
:  WARNING: tors C4   - C5   - C6   - O6   delta (lib-coord) :   0.034
:  WARNING: tors C4   - C5   - N7   - C8   delta (lib-coord) :   0.020
:  WARNING: tors N3   - C4   - N9   - C1'  delta (lib-coord) :   0.059
:  WARNING: tors C4   - N9   - C8   - N7   delta (lib-coord) :   0.034
: * CIFile  : libcheck_3GP.cif
: * PDBfile : libcheck_3GP.pdb
: * Plotfile: libcheck_3GP.ps
: Output dictionary 
:    mmcif : libcheck.lib
:    odb   : libcheck.odb
INFO:: libcheck status: 0
:<B><FONT COLOR="#FF0000"><!--SUMMARY_BEGIN-->
:<html> <!-- CCP4 HTML LOGFILE -->
:<hr>
:<!--SUMMARY_END--></FONT></B>
:<B><FONT COLOR="#FF0000"><!--SUMMARY_BEGIN-->
:<pre>
: 
: ###############################################################
: ###############################################################
: ###############################################################
: ### CCP4 6.5.019: Refmac_5.8.0135 version 5.8.0135 : 01/10/15##
: ###############################################################
: User: pemsley  Run date:  6/ 1/2018 Run time: 07:48:54 
:
:
: Please reference: Collaborative Computational Project, Number 4. 2011.
: "Overview of the CCP4 suite and current developments". Acta Cryst. D67, 235-242.
: as well as any specific reference in the program write-up.
:
:<!--SUMMARY_END--></FONT></B>
: $TEXT:Reference1: $$ Main reference $$ 
:   "REFMAC5 for the refinement of macromolecular crystal structures:"
:   G.N.Murshudov, P.Skubak, A.A.Lebedev, N.S.Pannu, R.A.Steiner, R.A.Nicholls, M.D.Winn, F.Long and A.A.Vagin,(2011) 
:   Acta Crystallogr. D67, 355-367
:
: $$
: $SUMMARY :Reference1:  $$ Refmac: $$
: :TEXT:Reference1: $$
:
: $TEXT:Reference2: $$ Secondary reference $$ 
:   "Refinement of Macromolecular Structures by the  Maximum-Likelihood Method:"
:   G.N. Murshudov, A.A.Vagin and E.J.Dodson,(1997)
:   Acta Crystallogr. D53, 240-255
:   EU  Validation contract: BIO2CT-92-0524
:
: $$
: $SUMMARY :Reference2:  $$ Refmac: $$
: :TEXT:Reference2: $$
:
:  Data line--- MODE NEWENTRY
:  Data line--- END
:===> Warning: Reflections file has not been defined
:===> Warning: Switching to the idealisation mode
:
:    ****                     Input and Default parameters#                      ****
:
:
:Input coordinate file.  Logical name - XYZIN actual file name  - coot-ccp4/libcheck_3GP.pdb
:Output coordinate file. Logical name - XYZOUT actual file name - coot-ccp4/monomer-3GP.pdb
:
:  Refinement type                        : Idealisation
:
:    ****                           Makecif parameters                           ****
:
:Dictionary files for restraints : /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/mon*cif
:Parameters for new entry and VDW: /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/monomers/ener_lib.cif
:User supplied dictionary entries: coot-ccp4/libcheck_3GP.cif
:    Apart from amino acids and DNA/RNA all monomers will be checked to see if atom names and connectivity is correct
:    Hydrogens will be restored in their riding positions
:    hydrogens will be written to the output file
:    Links between monomers will be checked. Only those links present in the coordinate file will be used
:    Standard sugar links will be analysed and used
:    For new ligands "ideal restraint" values will be taken from the energetic libary ener_lib.cif
:    Symmetry related links will be analysed and used
:    Cis peptides will be found and used automatically
:
:
:
:
:Monitoring style is "MEDIUM". Complete information will be printed out in the
:first and last cycle. In all other cycles minimum information will be printed out
:Sigma cutoffs for printing out outliers
:If deviation of restraint parameter > alpha*sigma then information will be printed out
:Distance outliers      10.000
:Angle outliers         10.000
:Torsion outliers       10.000
:Chiral volume outliers 10.000
:Plane outliers         10.000
:Non-bonding outliers   10.000
:---------------------------------------------------------------
:
: Input file :coot-ccp4/libcheck_3GP.pdb
:  ------------------------------
:  ---  LIBRARY OF MONOMERS   ---
: _lib_name         mon_lib
: _lib_version      5.44
: _lib_update       30/05/14
:  ------------------------------
:  NUMBER OF MONOMERS IN THE LIBRARY          : 11617
:                with complete description    : 11617
:  NUMBER OF MODIFICATIONS                    :    63
:  NUMBER OF LINKS                            :    73
:  I am reading libraries. Please wait.
:      - energy parameters
:      - monomer"s description (links & mod )
:
:FORMATTED      OLD     file opened on unit  45
:<B><FONT COLOR="#FF0000"><!--SUMMARY_BEGIN-->
:Logical name: ATOMSF, Filename: /lmb/home/public/xtal/CCP4/ccp4-64/ccp4-6.5-i2/ccp4-6.5/lib/data/atomsf.lib
:<!--SUMMARY_END--></FONT></B>
:
:  WARNING: "SCALE" card is absent in input PDB file
:  Number of atoms    :      24
:  Number of residues :       1
:  Number of chains   :       1
:  I am reading library. Please wait.
:                mon_lib.cif
:  --------------------------------
:  --- title of input coord file ---
:
:  PDB_code:3GP
:  PDB_name:coords of 3GP from prog: libcheck
:  PDB_date:XX-XXX-XX
:  --------------------------------
:  Number of chains                  :       1
:  Total number of monomers          :       1
:  Number of atoms                   :      36
:  Number of missing atoms           :       0
:  Number of rebuilt atoms           :      12
:  Number of unknown atoms           :       0
:  Number of deleted atoms           :       0
:
:
: loop_
:     _atom_type_symbol
:     _atom_type_scat_Cromer_Mann_a1
:     _atom_type_scat_Cromer_Mann_b1
:     _atom_type_scat_Cromer_Mann_a2
:     _atom_type_scat_Cromer_Mann_b2
:     _atom_type_scat_Cromer_Mann_a3
:     _atom_type_scat_Cromer_Mann_b3
:     _atom_type_scat_Cromer_Mann_a4
:     _atom_type_scat_Cromer_Mann_b4
:     _atom_type_scat_Cromer_Mann_c
:
:
:  O      3.0485  13.2771   2.2868   5.7011   1.5463   0.3239   0.8670  32.9089   0.2508
:  C      2.3100  20.8439   1.0200  10.2075   1.5886   0.5687   0.8650  51.6512   0.2156
:  N     12.2126   0.0057   3.1322   9.8933   2.0125  28.9975   1.1663   0.5826 -11.5290
:  H      0.4930  10.5109   0.3229  26.1257   0.1402   3.1424   0.0408  57.7997   0.0030
:  P      6.4345   1.9067   4.1791  27.1570   1.7800   0.5260   1.4908  68.1645   1.1149
:
:
: Number of distances         :           0
: Number of angles            :           0
: Number of torsions          :           0
: Number of planes            :           0
: Number of chirals           :           0
: Number of intervals         :           0
:--------------------------------------------------------------------------------
:--------------------------------------------------------------------------------
:                        Standard  External       All
:                Bonds:        36         0        36
:               Angles:        64         0        64
:              Chirals:         4         0         4
:               Planes:         2         0         2
:             Torsions:        20         0        20
:            Intervals:         0         0         0
:--------------------------------------------------------------------------------
:
:
:  Number of harmonic restraints       =            0
:  Number of atoms in special position =            0
: -----------------------------------------------------
:
: chir max =   0.0000000    
: chir_max =   0.0000000       3.0000000       5.0000000    
:
:
:     CGMAT cycle number =      1
:
: function value    101.82433    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.030     0.020
:Bond distances: others                           10     0.001     0.020
:Bond angles  : refined atoms                     40     4.292     3.000
:Bond angles  : others                            24     1.625     3.000
:Chiral centres: refined atoms                     4     0.186     0.200
:Planar groups: refined atoms                     14     0.002     0.020
:Planar groups: others                             6     0.005     0.020
:VDW repulsions.others                            12     0.183     0.200
:VDW; torsion: refined_atoms                      14     0.281     0.200
:VDW; torsion.others                              12     0.178     0.200
:-------------------------------------------------------------------------------
: Trying gamma equal    0.0000000    
: Not converging with gamma equal    0.0000000    
: Trying gamma equal   5.24999984E-02
: Gamma decreased to   4.19999994E-02
:
:
: fvalues    0.0000000       101.82433       36.313282       101.82433    
:
:
:     CGMAT cycle number =      2
:
: function value    36.313282    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.010     0.020
:Bond distances: others                           10     0.002     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.19999994E-02
: Gamma decreased to   3.24545428E-02
:
:
: fvalues    0.0000000       36.313282       32.770733       36.313282    
:
:
:     CGMAT cycle number =      3
:
: function value    32.770733    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   3.24545428E-02
: Gamma decreased to   2.37768572E-02
:
:
: fvalues    0.0000000       32.770733       32.165546       32.770733    
:
:
:     CGMAT cycle number =      4
:
: function value    32.165546    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   2.37768572E-02
: Gamma decreased to   1.58880539E-02
:
:
: fvalues    0.0000000       32.165546       31.749023       32.165546    
:
:
:     CGMAT cycle number =      5
:
: function value    31.749023    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   1.58880539E-02
: Not converging with gamma equal   1.58880539E-02
: Trying gamma equal   5.35391644E-02
: Gamma decreased to   4.60089408E-02
:
:
: fvalues    0.0000000       31.749023       31.600889       31.749023    
:
:
:     CGMAT cycle number =      6
:
: function value    31.600889    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.60089408E-02
: Not converging with gamma equal   4.60089408E-02
: Trying gamma equal   8.19486380E-02
: Not converging with gamma equal   8.19486380E-02
: Trying gamma equal   0.11968531    
: Gamma decreased to   0.11213798    
:
:
: fvalues    0.0000000       31.600889       31.536364       31.600889    
:
:
:     CGMAT cycle number =      7
:
: function value    31.536364    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   0.11213798    
: Gamma decreased to   0.10527676    
:
:
: fvalues    0.0000000       31.536364       31.471638       31.536364    
:
:
:     CGMAT cycle number =      8
:
: function value    31.471638    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   0.10527676    
: Gamma decreased to   9.90392938E-02
:
:
: fvalues    0.0000000       31.471638       31.406364       31.471638    
:
:
:     CGMAT cycle number =      9
:
: function value    31.406364    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   9.90392938E-02
: Gamma decreased to   9.33688730E-02
:
:
: fvalues    0.0000000       31.406364       31.340563       31.406364    
:
:
:     CGMAT cycle number =     10
:
: function value    31.340563    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   9.33688730E-02
: Gamma decreased to   8.82139429E-02
:
:
: fvalues    0.0000000       31.340563       31.274326       31.340563    
:
:
:     CGMAT cycle number =     11
:
: function value    31.274326    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   8.82139429E-02
: Gamma decreased to   8.35276395E-02
:
:
: fvalues    0.0000000       31.274326       31.207850       31.274326    
:
:
:     CGMAT cycle number =     12
:
: function value    31.207850    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   8.35276395E-02
: Gamma decreased to   7.92673677E-02
:
:
: fvalues    0.0000000       31.207850       31.141224       31.207850    
:
:
:     CGMAT cycle number =     13
:
: function value    31.141224    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   7.92673677E-02
: Gamma decreased to   7.53943920E-02
:
:
: fvalues    0.0000000       31.141224       31.074661       31.141224    
:
:
:     CGMAT cycle number =     14
:
: function value    31.074661    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   7.53943920E-02
: Gamma decreased to   7.18735084E-02
:
:
: fvalues    0.0000000       31.074661       31.008284       31.074661    
:
:
:     CGMAT cycle number =     15
:
: function value    31.008284    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   7.18735084E-02
: Gamma decreased to   6.86727017E-02
:
:
: fvalues    0.0000000       31.008284       30.942270       31.008284    
:
:
:     CGMAT cycle number =     16
:
: function value    30.942270    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.86727017E-02
: Gamma decreased to   6.57628775E-02
:
:
: fvalues    0.0000000       30.942270       30.876766       30.942270    
:
:
:     CGMAT cycle number =     17
:
: function value    30.876766    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.57628775E-02
: Not converging with gamma equal   6.57628775E-02
: Trying gamma equal   7.96506703E-02
: Gamma decreased to   7.68731087E-02
:
:
: fvalues    0.0000000       30.876766       30.822355       30.876766    
:
:
:     CGMAT cycle number =     18
:
: function value    30.822355    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   7.68731087E-02
: Gamma decreased to   7.43480548E-02
:
:
: fvalues    0.0000000       30.822355       30.768475       30.822355    
:
:
:     CGMAT cycle number =     19
:
: function value    30.768475    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   7.43480548E-02
: Gamma decreased to   7.20525533E-02
:
:
: fvalues    0.0000000       30.768475       30.715254       30.768475    
:
:
:     CGMAT cycle number =     20
:
: function value    30.715254    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   7.20525533E-02
: Gamma decreased to   6.99657351E-02
:
:
: fvalues    0.0000000       30.715254       30.662777       30.715254    
:
:
:     CGMAT cycle number =     21
:
: function value    30.662777    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.99657351E-02
: Gamma decreased to   6.80686235E-02
:
:
: fvalues    0.0000000       30.662777       30.611145       30.662777    
:
:
:     CGMAT cycle number =     22
:
: function value    30.611145    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.80686235E-02
: Gamma decreased to   6.63439780E-02
:
:
: fvalues    0.0000000       30.611145       30.560417       30.611145    
:
:
:     CGMAT cycle number =     23
:
: function value    30.560417    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.63439780E-02
: Gamma decreased to   6.47761226E-02
:
:
: fvalues    0.0000000       30.560417       30.510704       30.560417    
:
:
:     CGMAT cycle number =     24
:
: function value    30.510704    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.47761226E-02
: Gamma decreased to   6.33507967E-02
:
:
: fvalues    0.0000000       30.510704       30.462093       30.510704    
:
:
:     CGMAT cycle number =     25
:
: function value    30.462093    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.33507967E-02
: Not converging with gamma equal   6.33507967E-02
: Trying gamma equal   7.01534897E-02
: Gamma decreased to   6.87929541E-02
:
:
: fvalues    0.0000000       30.462093       30.418858       30.462093    
:
:
:     CGMAT cycle number =     26
:
: function value    30.418858    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.87929541E-02
: Gamma decreased to   6.75560981E-02
:
:
: fvalues    0.0000000       30.418858       30.376587       30.418858    
:
:
:     CGMAT cycle number =     27
:
: function value    30.376587    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.75560981E-02
: Gamma decreased to   6.64316863E-02
:
:
: fvalues    0.0000000       30.376587       30.335243       30.376587    
:
:
:     CGMAT cycle number =     28
:
: function value    30.335243    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.64316863E-02
: Gamma decreased to   6.54094964E-02
:
:
: fvalues    0.0000000       30.335243       30.294954       30.335243    
:
:
:     CGMAT cycle number =     29
:
: function value    30.294954    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.54094964E-02
: Gamma decreased to   6.44802302E-02
:
:
: fvalues    0.0000000       30.294954       30.255678       30.294954    
:
:
:     CGMAT cycle number =     30
:
: function value    30.255678    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.44802302E-02
: Gamma decreased to   6.36354461E-02
:
:
: fvalues    0.0000000       30.255678       30.217442       30.255678    
:
:
:     CGMAT cycle number =     31
:
: function value    30.217442    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.36354461E-02
: Gamma decreased to   6.28674552E-02
:
:
: fvalues    0.0000000       30.217442       30.180283       30.217442    
:
:
:     CGMAT cycle number =     32
:
: function value    30.180283    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.28674552E-02
: Gamma decreased to   6.21692836E-02
:
:
: fvalues    0.0000000       30.180283       30.144108       30.180283    
:
:
:     CGMAT cycle number =     33
:
: function value    30.144108    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.21692836E-02
: Gamma decreased to   6.15345836E-02
:
:
: fvalues    0.0000000       30.144108       30.109032       30.144108    
:
:
:     CGMAT cycle number =     34
:
: function value    30.109032    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.15345836E-02
: Gamma decreased to   6.09575808E-02
:
:
: fvalues    0.0000000       30.109032       30.074951       30.109032    
:
:
:     CGMAT cycle number =     35
:
: function value    30.074951    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.09575808E-02
: Gamma decreased to   6.04330339E-02
:
:
: fvalues    0.0000000       30.074951       30.041904       30.074951    
:
:
:     CGMAT cycle number =     36
:
: function value    30.041904    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.04330339E-02
: Gamma decreased to   5.99561743E-02
:
:
: fvalues    0.0000000       30.041904       30.009834       30.041904    
:
:
:     CGMAT cycle number =     37
:
: function value    30.009834    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.99561743E-02
: Gamma decreased to   5.95226660E-02
:
:
: fvalues    0.0000000       30.009834       29.978809       30.009834    
:
:
:     CGMAT cycle number =     38
:
: function value    29.978809    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.95226660E-02
: Gamma decreased to   5.91285676E-02
:
:
: fvalues    0.0000000       29.978809       29.948734       29.978809    
:
:
:     CGMAT cycle number =     39
:
: function value    29.948734    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.91285676E-02
: Not converging with gamma equal   5.91285676E-02
: Trying gamma equal   6.10094965E-02
: Gamma decreased to   6.06333092E-02
:
:
: fvalues    0.0000000       29.948734       29.920404       29.948734    
:
:
:     CGMAT cycle number =     40
:
: function value    29.920404    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:Bond angles  : refined atoms                     40     2.846     3.000
:Bond angles  : others                            24     0.650     3.000
:Chiral centres: refined atoms                     4     0.028     0.200
:Planar groups: refined atoms                     14     0.000     0.020
:Planar groups: others                             6     0.000     0.020
:VDW repulsions.others                             4     0.056     0.200
:VDW; torsion: refined_atoms                      12     0.243     0.200
:VDW; torsion.others                              12     0.067     0.200
:-------------------------------------------------------------------------------
: Trying gamma equal   6.06333092E-02
: Gamma decreased to   6.02913238E-02
:
:
: fvalues    0.0000000       29.920404       29.892975       29.920404    
:
:
:     CGMAT cycle number =      1
:
: function value    29.892975    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:Bond angles  : refined atoms                     40     2.844     3.000
:Bond angles  : others                            24     0.650     3.000
:Chiral centres: refined atoms                     4     0.028     0.200
:Planar groups: refined atoms                     14     0.000     0.020
:Planar groups: others                             6     0.000     0.020
:VDW repulsions.others                             4     0.056     0.200
:VDW; torsion: refined_atoms                      12     0.243     0.200
:VDW; torsion.others                              12     0.067     0.200
:-------------------------------------------------------------------------------
: Trying gamma equal    0.0000000    
: Not converging with gamma equal    0.0000000    
: Trying gamma equal   5.24999984E-02
: Not converging with gamma equal   5.24999984E-02
: Trying gamma equal   0.10762499    
: Gamma decreased to   9.65999961E-02
:
:
: fvalues    0.0000000       29.892975       29.877441       29.892975    
:
:
:     CGMAT cycle number =      2
:
: function value    29.877441    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   9.65999961E-02
: Gamma decreased to   8.65772665E-02
:
:
: fvalues    0.0000000       29.877441       29.860640       29.877441    
:
:
:     CGMAT cycle number =      3
:
: function value    29.860640    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   8.65772665E-02
: Gamma decreased to   7.74656981E-02
:
:
: fvalues    0.0000000       29.860640       29.842512       29.860640    
:
:
:     CGMAT cycle number =      4
:
: function value    29.842512    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   7.74656981E-02
: Gamma decreased to   6.91824555E-02
:
:
: fvalues    0.0000000       29.842512       29.822935       29.842512    
:
:
:     CGMAT cycle number =      5
:
: function value    29.822935    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.91824555E-02
: Gamma decreased to   6.16522320E-02
:
:
: fvalues    0.0000000       29.822935       29.801739       29.822935    
:
:
:     CGMAT cycle number =      6
:
: function value    29.801739    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.16522320E-02
: Gamma decreased to   5.48065752E-02
:
:
: fvalues    0.0000000       29.801739       29.778870       29.801739    
:
:
:     CGMAT cycle number =      7
:
: function value    29.778870    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.48065752E-02
: Gamma decreased to   4.85832505E-02
:
:
: fvalues    0.0000000       29.778870       29.754221       29.778870    
:
:
:     CGMAT cycle number =      8
:
: function value    29.754221    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.85832505E-02
: Not converging with gamma equal   4.85832505E-02
: Trying gamma equal   7.82854706E-02
: Gamma decreased to   7.23450258E-02
:
:
: fvalues    0.0000000       29.754221       29.737091       29.754221    
:
:
:     CGMAT cycle number =      9
:
: function value    29.737091    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   7.23450258E-02
: Gamma decreased to   6.69446215E-02
:
:
: fvalues    0.0000000       29.737091       29.719170       29.737091    
:
:
:     CGMAT cycle number =     10
:
: function value    29.719170    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.69446215E-02
: Gamma decreased to   6.20351620E-02
:
:
: fvalues    0.0000000       29.719170       29.700369       29.719170    
:
:
:     CGMAT cycle number =     11
:
: function value    29.700369    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.20351620E-02
: Gamma decreased to   5.75720184E-02
:
:
: fvalues    0.0000000       29.700369       29.680782       29.700369    
:
:
:     CGMAT cycle number =     12
:
: function value    29.680782    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.75720184E-02
: Gamma decreased to   5.35146147E-02
:
:
: fvalues    0.0000000       29.680782       29.660429       29.680782    
:
:
:     CGMAT cycle number =     13
:
: function value    29.660429    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.35146147E-02
: Gamma decreased to   4.98260669E-02
:
:
: fvalues    0.0000000       29.660429       29.639355       29.660429    
:
:
:     CGMAT cycle number =     14
:
: function value    29.639355    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.98260669E-02
: Not converging with gamma equal   4.98260669E-02
: Trying gamma equal   6.74305037E-02
: Gamma decreased to   6.39096200E-02
:
:
: fvalues    0.0000000       29.639355       29.622938       29.639355    
:
:
:     CGMAT cycle number =     15
:
: function value    29.622938    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.39096200E-02
: Gamma decreased to   6.07088134E-02
:
:
: fvalues    0.0000000       29.622938       29.606110       29.622938    
:
:
:     CGMAT cycle number =     16
:
: function value    29.606110    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.07088134E-02
: Gamma decreased to   5.77989891E-02
:
:
: fvalues    0.0000000       29.606110       29.588955       29.606110    
:
:
:     CGMAT cycle number =     17
:
: function value    29.588955    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.77989891E-02
: Gamma decreased to   5.51536940E-02
:
:
: fvalues    0.0000000       29.588955       29.571524       29.588955    
:
:
:     CGMAT cycle number =     18
:
: function value    29.571524    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.51536940E-02
: Gamma decreased to   5.27488813E-02
:
:
: fvalues    0.0000000       29.571524       29.553860       29.571524    
:
:
:     CGMAT cycle number =     19
:
: function value    29.553860    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.27488813E-02
: Gamma decreased to   5.05626872E-02
:
:
: fvalues    0.0000000       29.553860       29.536018       29.553860    
:
:
:     CGMAT cycle number =     20
:
: function value    29.536018    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.05626872E-02
: Not converging with gamma equal   5.05626872E-02
: Trying gamma equal   6.09967932E-02
: Gamma decreased to   5.89099713E-02
:
:
: fvalues    0.0000000       29.536018       29.520916       29.536018    
:
:
:     CGMAT cycle number =     21
:
: function value    29.520916    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.89099713E-02
: Gamma decreased to   5.70128597E-02
:
:
: fvalues    0.0000000       29.520916       29.505806       29.520916    
:
:
:     CGMAT cycle number =     22
:
: function value    29.505806    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.70128597E-02
: Gamma decreased to   5.52882142E-02
:
:
: fvalues    0.0000000       29.505806       29.490562       29.505806    
:
:
:     CGMAT cycle number =     23
:
: function value    29.490562    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.52882142E-02
: Gamma decreased to   5.37203550E-02
:
:
: fvalues    0.0000000       29.490562       29.475359       29.490562    
:
:
:     CGMAT cycle number =     24
:
: function value    29.475359    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.37203550E-02
: Gamma decreased to   5.22950292E-02
:
:
: fvalues    0.0000000       29.475359       29.460224       29.475359    
:
:
:     CGMAT cycle number =     25
:
: function value    29.460224    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.22950292E-02
: Gamma decreased to   5.09992763E-02
:
:
: fvalues    0.0000000       29.460224       29.445110       29.460224    
:
:
:     CGMAT cycle number =     26
:
: function value    29.445110    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.09992763E-02
: Gamma decreased to   4.98213209E-02
:
:
: fvalues    0.0000000       29.445110       29.430086       29.445110    
:
:
:     CGMAT cycle number =     27
:
: function value    29.430086    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.98213209E-02
: Gamma decreased to   4.87504527E-02
:
:
: fvalues    0.0000000       29.430086       29.415245       29.430086    
:
:
:     CGMAT cycle number =     28
:
: function value    29.415245    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.87504527E-02
: Gamma decreased to   4.77769338E-02
:
:
: fvalues    0.0000000       29.415245       29.400536       29.415245    
:
:
:     CGMAT cycle number =     29
:
: function value    29.400536    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.77769338E-02
: Not converging with gamma equal   4.77769338E-02
: Trying gamma equal   5.24232686E-02
: Gamma decreased to   5.14940023E-02
:
:
: fvalues    0.0000000       29.400536       29.387175       29.400536    
:
:
:     CGMAT cycle number =     30
:
: function value    29.387175    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.14940023E-02
: Gamma decreased to   5.06492145E-02
:
:
: fvalues    0.0000000       29.387175       29.373995       29.387175    
:
:
:     CGMAT cycle number =     31
:
: function value    29.373995    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.06492145E-02
: Gamma decreased to   4.98812273E-02
:
:
: fvalues    0.0000000       29.373995       29.360981       29.373995    
:
:
:     CGMAT cycle number =     32
:
: function value    29.360981    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.98812273E-02
: Gamma decreased to   4.91830558E-02
:
:
: fvalues    0.0000000       29.360981       29.348146       29.360981    
:
:
:     CGMAT cycle number =     33
:
: function value    29.348146    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.91830558E-02
: Gamma decreased to   4.85483557E-02
:
:
: fvalues    0.0000000       29.348146       29.335510       29.348146    
:
:
:     CGMAT cycle number =     34
:
: function value    29.335510    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.85483557E-02
: Gamma decreased to   4.79713529E-02
:
:
: fvalues    0.0000000       29.335510       29.323067       29.335510    
:
:
:     CGMAT cycle number =     35
:
: function value    29.323067    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.79713529E-02
: Gamma decreased to   4.74468060E-02
:
:
: fvalues    0.0000000       29.323067       29.310829       29.323067    
:
:
:     CGMAT cycle number =     36
:
: function value    29.310829    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.74468060E-02
: Gamma decreased to   4.69699465E-02
:
:
: fvalues    0.0000000       29.310829       29.298843       29.310829    
:
:
:     CGMAT cycle number =     37
:
: function value    29.298843    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.69699465E-02
: Gamma decreased to   4.65364382E-02
:
:
: fvalues    0.0000000       29.298843       29.287045       29.298843    
:
:
:     CGMAT cycle number =     38
:
: function value    29.287045    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.65364382E-02
: Gamma decreased to   4.61423397E-02
:
:
: fvalues    0.0000000       29.287045       29.275482       29.287045    
:
:
:     CGMAT cycle number =     39
:
: function value    29.275482    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.61423397E-02
: Gamma decreased to   4.57840674E-02
:
:
: fvalues    0.0000000       29.275482       29.264126       29.275482    
:
:
:     CGMAT cycle number =     40
:
: function value    29.264126    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:Bond angles  : refined atoms                     40     2.783     3.000
:Bond angles  : others                            24     0.651     3.000
:Chiral centres: refined atoms                     4     0.026     0.200
:Planar groups: refined atoms                     14     0.000     0.020
:Planar groups: others                             6     0.000     0.020
:VDW repulsions.others                             4     0.057     0.200
:VDW; torsion: refined_atoms                      12     0.243     0.200
:VDW; torsion.others                              12     0.073     0.200
:-------------------------------------------------------------------------------
: Trying gamma equal   4.57840674E-02
: Gamma decreased to   4.54583652E-02
:
:
: fvalues    0.0000000       29.264126       29.253000       29.264126    
:
:
:     CGMAT cycle number =      1
:
: function value    29.253000    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:Bond angles  : refined atoms                     40     2.781     3.000
:Bond angles  : others                            24     0.651     3.000
:Chiral centres: refined atoms                     4     0.026     0.200
:Planar groups: refined atoms                     14     0.000     0.020
:Planar groups: others                             6     0.000     0.020
:VDW repulsions.others                             4     0.057     0.200
:VDW; torsion: refined_atoms                      12     0.243     0.200
:VDW; torsion.others                              12     0.073     0.200
:-------------------------------------------------------------------------------
: Trying gamma equal    0.0000000    
: Not converging with gamma equal    0.0000000    
: Trying gamma equal   5.24999984E-02
: Gamma decreased to   4.19999994E-02
:
:
: fvalues    0.0000000       29.253000       29.243635       29.253000    
:
:
:     CGMAT cycle number =      2
:
: function value    29.243635    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.19999994E-02
: Gamma decreased to   3.24545428E-02
:
:
: fvalues    0.0000000       29.243635       29.232248       29.243635    
:
:
:     CGMAT cycle number =      3
:
: function value    29.232248    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   3.24545428E-02
: Not converging with gamma equal   3.24545428E-02
: Trying gamma equal   7.80123919E-02
: Gamma decreased to   6.89008236E-02
:
:
: fvalues    0.0000000       29.232248       29.226078       29.232248    
:
:
:     CGMAT cycle number =      4
:
: function value    29.226078    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.89008236E-02
: Gamma decreased to   6.06175810E-02
:
:
: fvalues    0.0000000       29.226078       29.219261       29.226078    
:
:
:     CGMAT cycle number =      5
:
: function value    29.219261    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.06175810E-02
: Gamma decreased to   5.30873574E-02
:
:
: fvalues    0.0000000       29.219261       29.211651       29.219261    
:
:
:     CGMAT cycle number =      6
:
: function value    29.211651    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.30873574E-02
: Gamma decreased to   4.62417006E-02
:
:
: fvalues    0.0000000       29.211651       29.203270       29.211651    
:
:
:     CGMAT cycle number =      7
:
: function value    29.203270    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.62417006E-02
: Gamma decreased to   4.00183760E-02
:
:
: fvalues    0.0000000       29.203270       29.193890       29.203270    
:
:
:     CGMAT cycle number =      8
:
: function value    29.193890    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.00183760E-02
: Not converging with gamma equal   4.00183760E-02
: Trying gamma equal   6.97205961E-02
: Gamma decreased to   6.37801513E-02
:
:
: fvalues    0.0000000       29.193890       29.187643       29.193890    
:
:
:     CGMAT cycle number =      9
:
: function value    29.187643    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.37801513E-02
: Gamma decreased to   5.83797470E-02
:
:
: fvalues    0.0000000       29.187643       29.181007       29.187643    
:
:
:     CGMAT cycle number =     10
:
: function value    29.181007    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.83797470E-02
: Gamma decreased to   5.34702875E-02
:
:
: fvalues    0.0000000       29.181007       29.173872       29.181007    
:
:
:     CGMAT cycle number =     11
:
: function value    29.173872    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.34702875E-02
: Gamma decreased to   4.90071438E-02
:
:
: fvalues    0.0000000       29.173872       29.166368       29.173872    
:
:
:     CGMAT cycle number =     12
:
: function value    29.166368    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.90071438E-02
: Gamma decreased to   4.49497402E-02
:
:
: fvalues    0.0000000       29.166368       29.158276       29.166368    
:
:
:     CGMAT cycle number =     13
:
: function value    29.158276    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.49497402E-02
: Gamma decreased to   4.12611924E-02
:
:
: fvalues    0.0000000       29.158276       29.149731       29.158276    
:
:
:     CGMAT cycle number =     14
:
: function value    29.149731    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.12611924E-02
: Not converging with gamma equal   4.12611924E-02
: Trying gamma equal   5.88656291E-02
: Gamma decreased to   5.53447418E-02
:
:
: fvalues    0.0000000       29.149731       29.143272       29.149731    
:
:
:     CGMAT cycle number =     15
:
: function value    29.143272    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.53447418E-02
: Gamma decreased to   5.21439351E-02
:
:
: fvalues    0.0000000       29.143272       29.136520       29.143272    
:
:
:     CGMAT cycle number =     16
:
: function value    29.136520    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.21439351E-02
: Gamma decreased to   4.92341109E-02
:
:
: fvalues    0.0000000       29.136520       29.129520       29.136520    
:
:
:     CGMAT cycle number =     17
:
: function value    29.129520    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.92341109E-02
: Gamma decreased to   4.65888157E-02
:
:
: fvalues    0.0000000       29.129520       29.122269       29.129520    
:
:
:     CGMAT cycle number =     18
:
: function value    29.122269    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.65888157E-02
: Gamma decreased to   4.41840030E-02
:
:
: fvalues    0.0000000       29.122269       29.114811       29.122269    
:
:
:     CGMAT cycle number =     19
:
: function value    29.114811    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.41840030E-02
: Gamma decreased to   4.19978090E-02
:
:
: fvalues    0.0000000       29.114811       29.107105       29.114811    
:
:
:     CGMAT cycle number =     20
:
: function value    29.107105    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.19978090E-02
: Gamma decreased to   4.00103591E-02
:
:
: fvalues    0.0000000       29.107105       29.099218       29.107105    
:
:
:     CGMAT cycle number =     21
:
: function value    29.099218    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.00103591E-02
: Not converging with gamma equal   4.00103591E-02
: Trying gamma equal   4.94959094E-02
: Gamma decreased to   4.75987978E-02
:
:
: fvalues    0.0000000       29.099218       29.092613       29.099218    
:
:
:     CGMAT cycle number =     22
:
: function value    29.092613    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.75987978E-02
: Gamma decreased to   4.58741523E-02
:
:
: fvalues    0.0000000       29.092613       29.085888       29.092613    
:
:
:     CGMAT cycle number =     23
:
: function value    29.085888    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.58741523E-02
: Gamma decreased to   4.43062931E-02
:
:
: fvalues    0.0000000       29.085888       29.079048       29.085888    
:
:
:     CGMAT cycle number =     24
:
: function value    29.079048    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.43062931E-02
: Gamma decreased to   4.28809673E-02
:
:
: fvalues    0.0000000       29.079048       29.072138       29.079048    
:
:
:     CGMAT cycle number =     25
:
: function value    29.072138    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.28809673E-02
: Gamma decreased to   4.15852144E-02
:
:
: fvalues    0.0000000       29.072138       29.065147       29.072138    
:
:
:     CGMAT cycle number =     26
:
: function value    29.065147    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.15852144E-02
: Not converging with gamma equal   4.15852144E-02
: Trying gamma equal   4.77694832E-02
: Gamma decreased to   4.65326309E-02
:
:
: fvalues    0.0000000       29.065147       29.058941       29.065147    
:
:
:     CGMAT cycle number =     27
:
: function value    29.058941    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.65326309E-02
: Gamma decreased to   4.54082191E-02
:
:
: fvalues    0.0000000       29.058941       29.052719       29.058941    
:
:
:     CGMAT cycle number =     28
:
: function value    29.052719    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.54082191E-02
: Gamma decreased to   4.43860255E-02
:
:
: fvalues    0.0000000       29.052719       29.046501       29.052719    
:
:
:     CGMAT cycle number =     29
:
: function value    29.046501    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.43860255E-02
: Gamma decreased to   4.34567593E-02
:
:
: fvalues    0.0000000       29.046501       29.040226       29.046501    
:
:
:     CGMAT cycle number =     30
:
: function value    29.040226    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.34567593E-02
: Gamma decreased to   4.26119715E-02
:
:
: fvalues    0.0000000       29.040226       29.033924       29.040226    
:
:
:     CGMAT cycle number =     31
:
: function value    29.033924    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.26119715E-02
: Not converging with gamma equal   4.26119715E-02
: Trying gamma equal   4.66439128E-02
: Gamma decreased to   4.58375253E-02
:
:
: fvalues    0.0000000       29.033924       29.028139       29.033924    
:
:
:     CGMAT cycle number =     32
:
: function value    29.028139    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.58375253E-02
: Gamma decreased to   4.51044440E-02
:
:
: fvalues    0.0000000       29.028139       29.022421       29.028139    
:
:
:     CGMAT cycle number =     33
:
: function value    29.022421    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.51044440E-02
: Gamma decreased to   4.44380082E-02
:
:
: fvalues    0.0000000       29.022421       29.016649       29.022421    
:
:
:     CGMAT cycle number =     34
:
: function value    29.016649    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.44380082E-02
: Gamma decreased to   4.38321568E-02
:
:
: fvalues    0.0000000       29.016649       29.010910       29.016649    
:
:
:     CGMAT cycle number =     35
:
: function value    29.010910    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.38321568E-02
: Gamma decreased to   4.32813838E-02
:
:
: fvalues    0.0000000       29.010910       29.005224       29.010910    
:
:
:     CGMAT cycle number =     36
:
: function value    29.005224    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.32813838E-02
: Gamma decreased to   4.27806787E-02
:
:
: fvalues    0.0000000       29.005224       28.999550       29.005224    
:
:
:     CGMAT cycle number =     37
:
: function value    28.999550    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.27806787E-02
: Gamma decreased to   4.23254929E-02
:
:
: fvalues    0.0000000       28.999550       28.993898       28.999550    
:
:
:     CGMAT cycle number =     38
:
: function value    28.993898    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.23254929E-02
: Not converging with gamma equal   4.23254929E-02
: Trying gamma equal   4.44979668E-02
: Gamma decreased to   4.40634713E-02
:
:
: fvalues    0.0000000       28.993898       28.988565       28.993898    
:
:
:     CGMAT cycle number =     39
:
: function value    28.988565    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.40634713E-02
: Gamma decreased to   4.36684750E-02
:
:
: fvalues    0.0000000       28.988565       28.983236       28.988565    
:
:
:     CGMAT cycle number =     40
:
: function value    28.983236    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:Bond angles  : refined atoms                     40     2.754     3.000
:Bond angles  : others                            24     0.651     3.000
:Chiral centres: refined atoms                     4     0.025     0.200
:Planar groups: refined atoms                     14     0.000     0.020
:Planar groups: others                             6     0.000     0.020
:VDW repulsions.others                             2     0.081     0.200
:VDW; torsion: refined_atoms                      12     0.243     0.200
:VDW; torsion.others                              12     0.075     0.200
:-------------------------------------------------------------------------------
: Trying gamma equal   4.36684750E-02
: Gamma decreased to   4.33093868E-02
:
:
: fvalues    0.0000000       28.983236       28.977982       28.983236    
:
:    ****                        Final optimisation stage                        ****
:
:
:
:     CGMAT cycle number =      1
:
: function value    28.977982    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:Bond angles  : refined atoms                     40     2.753     3.000
:Bond angles  : others                            24     0.651     3.000
:Chiral centres: refined atoms                     4     0.025     0.200
:Planar groups: refined atoms                     14     0.000     0.020
:Planar groups: others                             6     0.000     0.020
:VDW repulsions.others                             2     0.081     0.200
:VDW; torsion: refined_atoms                      12     0.243     0.200
:VDW; torsion.others                              12     0.076     0.200
:-------------------------------------------------------------------------------
: Trying gamma equal    0.0000000    
: Not converging with gamma equal    0.0000000    
: Trying gamma equal   5.24999984E-02
: Gamma decreased to   4.19999994E-02
:
:
: fvalues    0.0000000       28.977982       28.973661       28.977982    
:
:
:     CGMAT cycle number =      2
:
: function value    28.973661    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.19999994E-02
: Gamma decreased to   3.24545428E-02
:
:
: fvalues    0.0000000       28.973661       28.968380       28.973661    
:
:
:     CGMAT cycle number =      3
:
: function value    28.968380    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   3.24545428E-02
: Not converging with gamma equal   3.24545428E-02
: Trying gamma equal   7.80123919E-02
: Gamma decreased to   6.89008236E-02
:
:
: fvalues    0.0000000       28.968380       28.965488       28.968380    
:
:
:     CGMAT cycle number =      4
:
: function value    28.965488    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.89008236E-02
: Gamma decreased to   6.06175810E-02
:
:
: fvalues    0.0000000       28.965488       28.962254       28.965488    
:
:
:     CGMAT cycle number =      5
:
: function value    28.962254    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.06175810E-02
: Gamma decreased to   5.30873574E-02
:
:
: fvalues    0.0000000       28.962254       28.958670       28.962254    
:
:
:     CGMAT cycle number =      6
:
: function value    28.958670    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.30873574E-02
: Gamma decreased to   4.62417006E-02
:
:
: fvalues    0.0000000       28.958670       28.954634       28.958670    
:
:
:     CGMAT cycle number =      7
:
: function value    28.954634    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.62417006E-02
: Gamma decreased to   4.00183760E-02
:
:
: fvalues    0.0000000       28.954634       28.950089       28.954634    
:
:
:     CGMAT cycle number =      8
:
: function value    28.950089    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.00183760E-02
: Not converging with gamma equal   4.00183760E-02
: Trying gamma equal   6.97205961E-02
: Gamma decreased to   6.37801513E-02
:
:
: fvalues    0.0000000       28.950089       28.947037       28.950089    
:
:
:     CGMAT cycle number =      9
:
: function value    28.947037    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   6.37801513E-02
: Gamma decreased to   5.83797470E-02
:
:
: fvalues    0.0000000       28.947037       28.943735       28.947037    
:
:
:     CGMAT cycle number =     10
:
: function value    28.943735    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.83797470E-02
: Gamma decreased to   5.34702875E-02
:
:
: fvalues    0.0000000       28.943735       28.940212       28.943735    
:
:
:     CGMAT cycle number =     11
:
: function value    28.940212    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.34702875E-02
: Gamma decreased to   4.90071438E-02
:
:
: fvalues    0.0000000       28.940212       28.936430       28.940212    
:
:
:     CGMAT cycle number =     12
:
: function value    28.936430    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.90071438E-02
: Gamma decreased to   4.49497402E-02
:
:
: fvalues    0.0000000       28.936430       28.932369       28.936430    
:
:
:     CGMAT cycle number =     13
:
: function value    28.932369    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.49497402E-02
: Gamma decreased to   4.12611924E-02
:
:
: fvalues    0.0000000       28.932369       28.928024       28.932369    
:
:
:     CGMAT cycle number =     14
:
: function value    28.928024    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.12611924E-02
: Not converging with gamma equal   4.12611924E-02
: Trying gamma equal   5.88656291E-02
: Gamma decreased to   5.53447418E-02
:
:
: fvalues    0.0000000       28.928024       28.924654       28.928024    
:
:
:     CGMAT cycle number =     15
:
: function value    28.924654    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.53447418E-02
: Gamma decreased to   5.21439351E-02
:
:
: fvalues    0.0000000       28.924654       28.921169       28.924654    
:
:
:     CGMAT cycle number =     16
:
: function value    28.921169    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.21439351E-02
: Gamma decreased to   4.92341109E-02
:
:
: fvalues    0.0000000       28.921169       28.917494       28.921169    
:
:
:     CGMAT cycle number =     17
:
: function value    28.917494    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.92341109E-02
: Gamma decreased to   4.65888157E-02
:
:
: fvalues    0.0000000       28.917494       28.913664       28.917494    
:
:
:     CGMAT cycle number =     18
:
: function value    28.913664    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.65888157E-02
: Gamma decreased to   4.41840030E-02
:
:
: fvalues    0.0000000       28.913664       28.909664       28.913664    
:
:
:     CGMAT cycle number =     19
:
: function value    28.909664    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.41840030E-02
: Gamma decreased to   4.19978090E-02
:
:
: fvalues    0.0000000       28.909664       28.905521       28.909664    
:
:
:     CGMAT cycle number =     20
:
: function value    28.905521    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.19978090E-02
: Not converging with gamma equal   4.19978090E-02
: Trying gamma equal   5.24319150E-02
: Gamma decreased to   5.03450930E-02
:
:
: fvalues    0.0000000       28.905521       28.902020       28.905521    
:
:
:     CGMAT cycle number =     21
:
: function value    28.902020    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.03450930E-02
: Gamma decreased to   4.84479815E-02
:
:
: fvalues    0.0000000       28.902020       28.898426       28.902020    
:
:
:     CGMAT cycle number =     22
:
: function value    28.898426    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.84479815E-02
: Gamma decreased to   4.67233360E-02
:
:
: fvalues    0.0000000       28.898426       28.894768       28.898426    
:
:
:     CGMAT cycle number =     23
:
: function value    28.894768    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.67233360E-02
: Gamma decreased to   4.51554768E-02
:
:
: fvalues    0.0000000       28.894768       28.891022       28.894768    
:
:
:     CGMAT cycle number =     24
:
: function value    28.891022    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.51554768E-02
: Not converging with gamma equal   4.51554768E-02
: Trying gamma equal   5.26384413E-02
: Gamma decreased to   5.11418469E-02
:
:
: fvalues    0.0000000       28.891022       28.887703       28.891022    
:
:
:     CGMAT cycle number =     25
:
: function value    28.887703    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.11418469E-02
: Gamma decreased to   4.97813076E-02
:
:
: fvalues    0.0000000       28.887703       28.884359       28.887703    
:
:
:     CGMAT cycle number =     26
:
: function value    28.884359    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.97813076E-02
: Gamma decreased to   4.85444553E-02
:
:
: fvalues    0.0000000       28.884359       28.880930       28.884359    
:
:
:     CGMAT cycle number =     27
:
: function value    28.880930    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.85444553E-02
: Gamma decreased to   4.74200435E-02
:
:
: fvalues    0.0000000       28.880930       28.877552       28.880930    
:
:
:     CGMAT cycle number =     28
:
: function value    28.877552    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.74200435E-02
: Gamma decreased to   4.63978499E-02
:
:
: fvalues    0.0000000       28.877552       28.874088       28.877552    
:
:
:     CGMAT cycle number =     29
:
: function value    28.874088    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.63978499E-02
: Not converging with gamma equal   4.63978499E-02
: Trying gamma equal   5.12764975E-02
: Gamma decreased to   5.03007695E-02
:
:
: fvalues    0.0000000       28.874088       28.870937       28.874088    
:
:
:     CGMAT cycle number =     30
:
: function value    28.870937    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   5.03007695E-02
: Gamma decreased to   4.94137406E-02
:
:
: fvalues    0.0000000       28.870937       28.867744       28.870937    
:
:
:     CGMAT cycle number =     31
:
: function value    28.867744    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.94137406E-02
: Gamma decreased to   4.86073531E-02
:
:
: fvalues    0.0000000       28.867744       28.864532       28.867744    
:
:
:     CGMAT cycle number =     32
:
: function value    28.864532    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.86073531E-02
: Gamma decreased to   4.78742719E-02
:
:
: fvalues    0.0000000       28.864532       28.861330       28.864532    
:
:
:     CGMAT cycle number =     33
:
: function value    28.861330    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.78742719E-02
: Gamma decreased to   4.72078361E-02
:
:
: fvalues    0.0000000       28.861330       28.858130       28.861330    
:
:
:     CGMAT cycle number =     34
:
: function value    28.858130    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.72078361E-02
: Not converging with gamma equal   4.72078361E-02
: Trying gamma equal   5.03885560E-02
: Gamma decreased to   4.97524105E-02
:
:
: fvalues    0.0000000       28.858130       28.855083       28.858130    
:
:
:     CGMAT cycle number =     35
:
: function value    28.855083    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.97524105E-02
: Gamma decreased to   4.91740964E-02
:
:
: fvalues    0.0000000       28.855083       28.852051       28.855083    
:
:
:     CGMAT cycle number =     36
:
: function value    28.852051    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.91740964E-02
: Gamma decreased to   4.86483574E-02
:
:
: fvalues    0.0000000       28.852051       28.849003       28.852051    
:
:
:     CGMAT cycle number =     37
:
: function value    28.849003    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.86483574E-02
: Gamma decreased to   4.81704138E-02
:
:
: fvalues    0.0000000       28.849003       28.845972       28.849003    
:
:
:     CGMAT cycle number =     38
:
: function value    28.845972    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.81704138E-02
: Not converging with gamma equal   4.81704138E-02
: Trying gamma equal   5.04515134E-02
: Gamma decreased to   4.99952920E-02
:
:
: fvalues    0.0000000       28.845972       28.843063       28.845972    
:
:
:     CGMAT cycle number =     39
:
: function value    28.843063    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:-------------------------------------------------------------------------------
: Trying gamma equal   4.99952920E-02
: Gamma decreased to   4.95805480E-02
:
:
: fvalues    0.0000000       28.843063       28.840176       28.843063    
:
:
:     CGMAT cycle number =     40
:
: function value    28.840176    
:
:-------------------------------------------------------------------------------
:             Restraint type              N restraints   Rms Delta   Av(Sigma)
:Bond distances: refined atoms                    26     0.007     0.020
:Bond distances: others                           10     0.000     0.020
:Bond angles  : refined atoms                     40     2.740     3.000
:Bond angles  : others                            24     0.651     3.000
:Chiral centres: refined atoms                     4     0.024     0.200
:Planar groups: refined atoms                     14     0.000     0.020
:Planar groups: others                             6     0.000     0.020
:VDW repulsions.others                             2     0.081     0.200
:VDW; torsion: refined_atoms                      14     0.225     0.200
:VDW; torsion.others                              12     0.077     0.200
:-------------------------------------------------------------------------------
: Trying gamma equal   4.95805480E-02
: Gamma decreased to   4.92035076E-02
:
:
: fvalues    0.0000000       28.840176       28.837288       28.840176    
: chir_max =  4.13386822E-02
: rms =  0.35088748    
: angle =  0.91783828    
:  Time in seconds: CPU =         0.72
:             Elapsed =           0.00
:
:    ****           Things for loggraph, R factor and others vs cycle            ****
:
:
:$TABLE: Rfactor analysis, stats vs cycle  :
:$GRAPHS:<Rfactor> vs cycle :N:1,2,3:
::FOM vs cycle :N:1,4:
::-LL vs cycle :N:1,5:
::-LLfree vs cycle :N:1,6:
::Geometry vs cycle:N:1,7,8,9,10,11:
:$$
:    Ncyc    Rfact    Rfree     FOM      -LL     -LLfree  rmsBOND  zBOND rmsANGL  zANGL rmsCHIRAL $$
:$$
:       0   0.0      0.0      0.0             0.       0.0   0.0304  1.521   4.292  1.431   0.186
:       1   0.0      0.0      0.0             0.       0.0   0.0097  0.483   3.122  1.041   0.030
:       2   0.0      0.0      0.0             0.       0.0   0.0072  0.358   3.050  1.017   0.030
:       3   0.0      0.0      0.0             0.       0.0   0.0071  0.356   3.020  1.007   0.032
:       4   0.0      0.0      0.0             0.       0.0   0.0071  0.356   2.995  0.998   0.033
:       5   0.0      0.0      0.0             0.       0.0   0.0071  0.355   2.985  0.995   0.032
:       6   0.0      0.0      0.0             0.       0.0   0.0071  0.355   2.981  0.994   0.032
:       7   0.0      0.0      0.0             0.       0.0   0.0071  0.355   2.976  0.992   0.032
:       8   0.0      0.0      0.0             0.       0.0   0.0071  0.355   2.971  0.990   0.032
:       9   0.0      0.0      0.0             0.       0.0   0.0071  0.355   2.967  0.989   0.032
:      10   0.0      0.0      0.0             0.       0.0   0.0071  0.355   2.962  0.987   0.032
:      11   0.0      0.0      0.0             0.       0.0   0.0071  0.355   2.957  0.986   0.032
:      12   0.0      0.0      0.0             0.       0.0   0.0071  0.354   2.951  0.984   0.032
:      13   0.0      0.0      0.0             0.       0.0   0.0071  0.354   2.946  0.982   0.032
:      14   0.0      0.0      0.0             0.       0.0   0.0071  0.354   2.941  0.980   0.031
:      15   0.0      0.0      0.0             0.       0.0   0.0071  0.354   2.935  0.978   0.031
:      16   0.0      0.0      0.0             0.       0.0   0.0071  0.354   2.930  0.977   0.031
:      17   0.0      0.0      0.0             0.       0.0   0.0071  0.354   2.926  0.975   0.031
:      18   0.0      0.0      0.0             0.       0.0   0.0071  0.354   2.921  0.974   0.031
:      19   0.0      0.0      0.0             0.       0.0   0.0071  0.354   2.917  0.972   0.031
:      20   0.0      0.0      0.0             0.       0.0   0.0071  0.353   2.912  0.971   0.030
:      21   0.0      0.0      0.0             0.       0.0   0.0071  0.353   2.908  0.969   0.030
:      22   0.0      0.0      0.0             0.       0.0   0.0071  0.353   2.903  0.968   0.030
:      23   0.0      0.0      0.0             0.       0.0   0.0071  0.353   2.899  0.966   0.030
:      24   0.0      0.0      0.0             0.       0.0   0.0071  0.353   2.895  0.965   0.030
:      25   0.0      0.0      0.0             0.       0.0   0.0071  0.353   2.891  0.964   0.030
:      26   0.0      0.0      0.0             0.       0.0   0.0071  0.353   2.888  0.963   0.030
:      27   0.0      0.0      0.0             0.       0.0   0.0071  0.353   2.884  0.961   0.029
:      28   0.0      0.0      0.0             0.       0.0   0.0071  0.353   2.880  0.960   0.029
:      29   0.0      0.0      0.0             0.       0.0   0.0071  0.353   2.877  0.959   0.029
:      30   0.0      0.0      0.0             0.       0.0   0.0071  0.353   2.873  0.958   0.029
:      31   0.0      0.0      0.0             0.       0.0   0.0071  0.353   2.870  0.957   0.029
:      32   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.867  0.956   0.029
:      33   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.864  0.955   0.029
:      34   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.861  0.954   0.029
:      35   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.858  0.953   0.029
:      36   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.855  0.952   0.028
:      37   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.852  0.951   0.028
:      38   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.849  0.950   0.028
:      39   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.846  0.949   0.028
:      40   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.844  0.948   0.028
:      41   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.842  0.947   0.028
:      42   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.841  0.947   0.028
:      43   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.839  0.946   0.028
:      44   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.837  0.946   0.028
:      45   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.835  0.945   0.028
:      46   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.833  0.944   0.028
:      47   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.831  0.944   0.028
:      48   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.829  0.943   0.028
:      49   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.828  0.943   0.028
:      50   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.826  0.942   0.028
:      51   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.824  0.941   0.028
:      52   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.822  0.941   0.027
:      53   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.820  0.940   0.027
:      54   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.818  0.939   0.027
:      55   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.817  0.939   0.027
:      56   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.815  0.938   0.027
:      57   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.813  0.938   0.027
:      58   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.812  0.937   0.027
:      59   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.810  0.937   0.027
:      60   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.808  0.936   0.027
:      61   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.807  0.936   0.027
:      62   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.805  0.935   0.027
:      63   0.0      0.0      0.0             0.       0.0   0.0070  0.352   2.804  0.935   0.027
:      64   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.802  0.934   0.027
:      65   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.801  0.934   0.027
:      66   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.799  0.933   0.027
:      67   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.798  0.933   0.027
:      68   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.796  0.932   0.027
:      69   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.795  0.932   0.027
:      70   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.794  0.931   0.027
:      71   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.792  0.931   0.026
:      72   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.791  0.930   0.026
:      73   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.790  0.930   0.026
:      74   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.789  0.930   0.026
:      75   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.787  0.929   0.026
:      76   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.786  0.929   0.026
:      77   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.785  0.928   0.026
:      78   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.784  0.928   0.026
:      79   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.783  0.928   0.026
:      80   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.781  0.927   0.026
:      81   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.780  0.927   0.026
:      82   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.779  0.926   0.026
:      83   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.779  0.926   0.026
:      84   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.778  0.926   0.026
:      85   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.777  0.926   0.026
:      86   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.776  0.925   0.026
:      87   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.775  0.925   0.026
:      88   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.775  0.925   0.026
:      89   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.774  0.925   0.026
:      90   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.773  0.924   0.026
:      91   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.772  0.924   0.026
:      92   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.772  0.924   0.026
:      93   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.771  0.924   0.026
:      94   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.770  0.923   0.026
:      95   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.769  0.923   0.026
:      96   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.769  0.923   0.026
:      97   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.768  0.923   0.026
:      98   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.767  0.922   0.026
:      99   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.766  0.922   0.026
:     100   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.765  0.922   0.026
:     101   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.765  0.922   0.026
:     102   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.764  0.921   0.025
:     103   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.763  0.921   0.025
:     104   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.763  0.921   0.025
:     105   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.762  0.921   0.025
:     106   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.761  0.920   0.025
:     107   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.761  0.920   0.025
:     108   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.760  0.920   0.025
:     109   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.759  0.920   0.025
:     110   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.759  0.920   0.025
:     111   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.758  0.919   0.025
:     112   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.757  0.919   0.025
:     113   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.757  0.919   0.025
:     114   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.756  0.919   0.025
:     115   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.756  0.919   0.025
:     116   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.755  0.918   0.025
:     117   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.755  0.918   0.025
:     118   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.754  0.918   0.025
:     119   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.754  0.918   0.025
:     120   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.753  0.918   0.025
:     121   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.753  0.918   0.025
:     122   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.752  0.917   0.025
:     123   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.752  0.917   0.025
:     124   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.751  0.917   0.025
:     125   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.751  0.917   0.025
:     126   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.751  0.917   0.025
:     127   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.750  0.917   0.025
:     128   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.750  0.917   0.025
:     129   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.750  0.917   0.025
:     130   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.749  0.916   0.025
:     131   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.749  0.916   0.025
:     132   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.748  0.916   0.025
:     133   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.748  0.916   0.025
:     134   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.748  0.916   0.025
:     135   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.747  0.916   0.025
:     136   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.747  0.916   0.025
:     137   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.747  0.916   0.025
:     138   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.746  0.915   0.025
:     139   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.746  0.915   0.025
:     140   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.746  0.915   0.025
:     141   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.745  0.915   0.025
:     142   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.745  0.915   0.025
:     143   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.744  0.915   0.025
:     144   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.744  0.915   0.025
:     145   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.744  0.915   0.025
:     146   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.744  0.915   0.025
:     147   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.743  0.914   0.025
:     148   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.743  0.914   0.025
:     149   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.743  0.914   0.024
:     150   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.742  0.914   0.024
:     151   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.742  0.914   0.024
:     152   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.742  0.914   0.024
:     153   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.741  0.914   0.024
:     154   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.741  0.914   0.024
:     155   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.741  0.914   0.024
:     156   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.741  0.914   0.024
:     157   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.740  0.913   0.024
:     158   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.740  0.913   0.024
:     159   0.0      0.0      0.0             0.       0.0   0.0070  0.351   2.740  0.913   0.024
: $$
: $TEXT:Result: $$ Final results $$
: $$
: Harvest: NO PNAME_KEYWRD given - no deposit file created
:<B><FONT COLOR="#FF0000"><!--SUMMARY_BEGIN-->
: Refmac_5.8.0135:  End of Refmac_5.8.0135  
:Times: User:       5.6s System:    0.5s Elapsed:     0:06  
:</pre>
:</html>
:<!--SUMMARY_END--></FONT></B>
INFO:: libcheck-minimal? is #f
PASS: Get monomer test
Entered testcase - Set Bond thickness
PASS: Set Bond thickness
Entered testcase - Delete all-molecule Hydrogens
here 1 
PASS: Delete all-molecule Hydrogens
Entered testcase - Non-Autoloads
PASS: Non-Autoloads
Entered testcase - Move and Refine Ligand test
PASS: Move and Refine Ligand test
Entered testcase - Many Molecules - Ligand Fitting
   Fitting NPO gave these results: #<unspecified>
PASS: Many Molecules - Ligand Fitting
Entered testcase - flip residue (around eigen vectors)
distance: 4.05825923997285
distance d2: 4.95113364632015e-7
PASS: flip residue (around eigen vectors)
Entered testcase - Test dipole
info:: dipole components (-2.21999993920326 4.44089209850063e-16 0.0) 
PASS: Test dipole
Entered testcase - Reading new dictionary restraints replaces
PASS: Reading new dictionary restraints replaces
Entered testcase - Pyrogen Runs OK?
PASS: Pyrogen Runs OK?
Entered testcase - pyrogen dictionary does not make double-quoted atom names
PASS: pyrogen dictionary does not make double-quoted atom names
Ended 03-ligand.scm
Running 04-cootaneer.scm ...
Entered testcase - Assignment of new PIR sequence overwrites old assignment
debug seq: ("A" . "ACDEFGHIKLMNPQ")
PASS: Assignment of new PIR sequence overwrites old assignment
Entered testcase - Cootaneer Beta Strand
   Cootaneering: imol 137 chain-id "B" resno 60 inscode "" at-name " CA " alt-conf ""
PASS: Cootaneer Beta Strand
Ended 04-cootaneer.scm
Running 05-rna-ghosts.scm ...
Entered testcase - RNA NCS Ghosts
   There are 8 residues in chain "A"
   There are 8 residues in chain "B"
PASS: RNA NCS Ghosts
Ended 05-rna-ghosts.scm
Running 06-ssm.scm ...
Entered testcase - SSM - Frank von Delft's Example
PASS: SSM - Frank von Delft's Example
Entered testcase - SSM - Alice Dawson's Example
    0    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    2    "/lmb/home/pemsley/data/greg-data/ins-code-fragment-pre.pdb"
    3    "/lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz FWT PHWT"
    4    "/lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz FWT PHWT"
    5    "/lmb/home/pemsley/data/greg-data/3hfl_sigmaa.mtz 2FOFCWT PH2FOFCWT"
    6    "test-3hfl.map"
    7    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    8    "mainchain"
    9    "/lmb/home/pemsley/data/greg-data/tutorial-add-terminal-1-test.pdb"
    10    "atom selection from tutorial-add-terminal-1-test.pdb"
    11    "/lmb/home/pemsley/data/greg-data/frag-2wot.pdb"
    12    "sphere selection from tutorial-modern.pdb"
    14    "/lmb/home/pemsley/data/greg-data/rotamer-test-fragment.pdb"
    15    "/lmb/home/pemsley/data/greg-data/res098.pdb"
    16    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    17    "/lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz FWT PHWT"
    18    "/lmb/home/pemsley/data/greg-data/pdb3knw.ent"
    19    "/lmb/home/pemsley/data/greg-data/pdb1py3.ent"
    22    "/lmb/home/pemsley/data/greg-data/alt-conf-pepflip-test.pdb"
    23    "/lmb/home/pemsley/data/greg-data/tutorial-modern-cis-pep-12A_refmac0.pdb"
    24    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    25    "/lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz FWT PHWT"
    26    "/lmb/home/pemsley/data/greg-data/tutorial-add-terminal-1-test.pdb"
    27    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    28    "/lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz FWT PHWT"
    29    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    30    "/lmb/home/pemsley/data/greg-data/alt-conf-waters.pdb"
    31    "/lmb/home/pemsley/data/greg-data/backrub-fragment.pdb"
    32    "Copy_of_/lmb/home/pemsley/data/greg-data/backrub-fragment.pdb"
    33    "/lmb/home/pemsley/data/greg-data/coords-B3A.pdb"
    34    "/lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz /RNASE3GMP/COMPLEX/FWT /RNASE3GMP/COMPLEX/PHWT"
    35    "/lmb/home/pemsley/data/greg-data/test-TER-OXT.pdb"
    36    "/lmb/home/pemsley/data/greg-data/val.pdb"
    37    "/lmb/home/pemsley/data/greg-data/2yie-frag.pdb"
    38    "/lmb/home/pemsley/data/greg-data/4f8g.pdb"
    39    "/lmb/home/pemsley/data/greg-data/4f8g.pdb"
    40    "/lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz FWT PHWT"
    41    "/lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz FWT PHWT"
    42    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    43    "Generic Masked Map"
    44    "difference-map"
    47    "/lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz FWT PHWT"
    48    "/lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz FWT PHWT"
    49    "averaged-map"
    50    "difference-map"
    51    "/lmb/home/pemsley/data/greg-data/multi-carbo-coot-3.pdb"
    52    "/lmb/home/pemsley/data/greg-data/pdb2qc1-sans-cho.pdb"
    53    "/lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz FWT PHWT"
    54    "/lmb/home/pemsley/data/greg-data/monomer-VAL.pdb"
    55    "/lmb/home/pemsley/data/greg-data/3ins-6B-3.0-no-peptide-D.pdb"
    56    "atom selection from tutorial-modern.pdb"
    57    "/lmb/home/pemsley/data/greg-data/monomer-ACT.pdb"
    58    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    59    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    60    "Copy_of_/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    61    "atom selection from tutorial-modern.pdb"
    62    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    63    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    64    "/lmb/home/pemsley/data/greg-data/rnase-A-needs-an-insertion.pdb"
    65    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    66    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    67    "/lmb/home/pemsley/data/greg-data/pdb3hfl.ent"
    68    "/lmb/home/pemsley/data/greg-data/3hfl_sigmaa.mtz 2FOFCWT PH2FOFCWT"
    69    "Ideal-A-form-RNA"
    70    "Ideal-A-form-RNA"
    71    "Ideal-A-form-DNA"
    72    "Ideal-A-form-DNA"
    73    "Copy_of_/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    74    "/lmb/home/pemsley/data/greg-data/some-waters-with-ter.pdb"
    75    "/lmb/home/pemsley/data/greg-data/tm+some-waters.pdb"
    76    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    77    "/lmb/home/pemsley/data/greg-data/water-test-no-cell.pdb"
    78    "/lmb/home/pemsley/data/greg-data/pathological-water-test.pdb"
    79    "Copy_of_/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    80    "/lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz FWT PHWT"
    81    "Copy_of_/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    82    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    83    "/lmb/home/pemsley/data/greg-data/pdb1hvv.ent"
    84    "/lmb/home/pemsley/data/greg-data/monomer-ACT.pdb"
    85    "/lmb/home/pemsley/data/greg-data/monomer-NPO.pdb"
    86    "SymOp_-X,-X+Y,-Z+1/3_Copy_of_83"
    87    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    88    "atom selection from tutorial-modern.pdb"
    89    "Copy_of_/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    90    "Copy_of_/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    91    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    92    "/lmb/home/pemsley/data/greg-data/pdb1py3.ent"
    93    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    94    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    95    "/lmb/home/pemsley/data/greg-data/2goz-manip.pdb"
    96    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    97    "/lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz FWT PHWT"
    98    "/lmb/home/pemsley/data/greg-data/HOF.RES"
    99    "/lmb/home/pemsley/data/greg-data/hollander.ins"
    102    "/lmb/home/pemsley/data/greg-data/insulin.fcf Diff-SigmaA"
    103    "atom selection from insulin.res"
    104    "atom selection from insulin.res"
    106    "/lmb/home/pemsley/data/greg-data/horma-p21.res"
    107    "new-horma.ins"
    108    "/lmb/home/pemsley/data/greg-data/crash.hat"
    109    "coot-ccp4/monomer-3GP.pdb"
    110    "/lmb/home/pemsley/data/greg-data/monomer-3GP.pdb"
    111    "/lmb/home/pemsley/data/greg-data/test-LIG.pdb"
    112    "/lmb/home/pemsley/data/greg-data/test-LIG.pdb"
    113    "/lmb/home/pemsley/data/greg-data/monomer-NPO.pdb"
    114    "Copy_of_/lmb/home/pemsley/data/greg-data/monomer-NPO.pdb"
    115    "Copy_of_/lmb/home/pemsley/data/greg-data/monomer-NPO.pdb"
    116    "Copy_of_/lmb/home/pemsley/data/greg-data/monomer-NPO.pdb"
    117    "Copy_of_/lmb/home/pemsley/data/greg-data/monomer-NPO.pdb"
    118    "Copy_of_/lmb/home/pemsley/data/greg-data/monomer-NPO.pdb"
    119    "/lmb/home/pemsley/data/greg-data/pdb43ca-sans-NPO-refmaced.pdb"
    120    "/lmb/home/pemsley/data/greg-data/pdb43ca-sans-NPO-refmaced.mtz FWT PHWT"
    121    "/lmb/home/pemsley/data/greg-data/pdb43ca-sans-NPO-refmaced.mtz DELFWT PHDELWT"
    122    "Masked (by protein)"
    123    "Fitted ligand #0-0"
    124    "Fitted ligand #1-0"
    125    "Fitted ligand #2-0"
    126    "Fitted ligand #3-0"
    127    "Fitted ligand #4-0"
    128    "Fitted ligand #5-0"
    129    "Fitted ligand #6-0"
    130    "Fitted ligand #7-0"
    131    "Fitted ligand #8-0"
    132    "Fitted ligand #9-0"
    133    "coot-ccp4/monomer-3GP.pdb"
    134    "Copy_of_coot-ccp4/monomer-3GP.pdb"
    135    "/lmb/home/pemsley/data/greg-data/dipole-residues.pdb"
    136    "/lmb/home/pemsley/data/greg-data/tutorial-modern.pdb"
    137    "/lmb/home/pemsley/data/greg-data/crashes_on_cootaneering-v2.pdb"
    138    "/lmb/home/pemsley/data/greg-data/rnasa-1.8-all_refmac1.mtz FWT PHWT"
    139    "Ideal-A-form-RNA"
    142    "/lmb/home/pemsley/data/greg-data/1wly.pdb"
    143    "/lmb/home/pemsley/data/greg-data/1yb5.pdb"
PASS: SSM - Alice Dawson's Example
Entered testcase - SSM by atom selection [JED Example]
PASS: SSM by atom selection [JED Example]
Ended 06-ssm.scm
Running 07-ncs.scm ...
Entered testcase - NCS maps test
PASS: NCS maps test
Entered testcase - NCS chains info
   NCS info: (("A" "B"))
PASS: NCS chains info
Entered testcase - NCS deviation info
PASS: NCS deviation info
Entered testcase - NCS Residue Range copy
PASS: NCS Residue Range copy
Entered testcase - NCS Residue Range edit to all chains
result: (#t #t)
PASS: NCS Residue Range edit to all chains
Entered testcase - Manual NCS ghosts generates correct NCS chain ids
   NCS ghost chain IDs pre:  (("B" "A" "C" "D"))
   NCS ghost chain IDs post: (("B" "A" "C" "D"))
PASS: Manual NCS ghosts generates correct NCS chain ids
Entered testcase - NCS maps overwrite existing maps
==== test-name: "Map 159 NCS found from matching Chain B onto Chain A"   n-matchers: 2
==== test-name: "Map 159 NCS found from matching Chain C onto Chain A"   n-matchers: 2
==== test-name: "Map 159 NCS found from matching Chain D onto Chain A"   n-matchers: 2
PASS: NCS maps overwrite existing maps
Ended 07-ncs.scm
Running 08-utils.scm ...
Entered testcase - Test key symbols
WARNING:: could not find key-sym-code for "missing key"
PASS: Test key symbols
Entered testcase - Test running a Python function
   test_val_2 passed
   test_val_3 passed
PASS: Test running a Python function
Entered testcase - Internal/External Molecule Numbers match
PASS: Internal/External Molecule Numbers match
Entered testcase - spacegroup operators to space group conversion
PASS: spacegroup operators to space group conversion
Ended 08-utils.scm
Running 09-internal.scm ...
Entered testcase - Test internal functions
PASS: Test internal functions
Ended 09-internal.scm

                === greg-tests Summary ===

# of testcases attempted   125
# of expected passes       125
# of expected failures     0
# of unexpected passes     0
# of unexpected failures   0
# of unresolved testcases  0
# of unsupported testcases 0
# of untested testcases    0

Loading greg-tests/end.grg ...
Loaded greg-tests/end.grg

                === Summary of all tests ===

# of tools                 1
# of testcases attempted   125
# of expected passes       125
# of expected failures     0
# of unexpected passes     0
# of unexpected failures   0
# of unresolved testcases  0
# of unsupported testcases 0
# of untested testcases    0
# of files abandoned       0

ObjectCache: Leaked 0002 refs to <P 2ac 2ab Nuvw = ( 160, 192,  96)>
ObjectCache: Leaked 0003 refs to <C 2c 2 Nuvw = ( 160, 160, 336)>
ObjectCache: Leaked 0002 refs to <P 2ac 2ab>
ObjectCache: Leaked 0003 refs to <C 2c 2>
test_coot: coot test passed